SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000038900 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000038900
Domain Number 1 Region: 397-497
Classification Level Classification E-value
Superfamily E set domains 1.87e-26
Family Filamin repeat (rod domain) 0.0017
Further Details:      
 
Domain Number 2 Region: 185-243
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000275
Family B-box zinc-binding domain 0.0033
Further Details:      
 
Domain Number 3 Region: 24-56
Classification Level Classification E-value
Superfamily RING/U-box 0.000000984
Family RING finger domain, C3HC4 0.0075
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000038900
Domain Number - Region: 224-328
Classification Level Classification E-value
Superfamily Apolipoprotein 0.000353
Family Apolipoprotein 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000038900   Gene: ENSPTRG00000001163   Transcript: ENSPTRT00000002164
Sequence length 580
Comment pep:known chromosome:CHIMP2.1.4:1:119600306:119609825:1 gene:ENSPTRG00000001163 transcript:ENSPTRT00000002164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSENRKPLLGFVSKLPSGTALGNSAKTHCPLCLGLFKAPRLLPCLHTVCTTCLEQLEPFS
VVDIRGGDSDTSSEGSIFQELKPRSLQSQIGILCPVCDAQVDLPMGGVKALTIDHLAVND
VMPESLRGEGQGLVCDLCNDREVEKRCQTCKANLCHFCCQAHRRQKKTTYHTMVDLKDLK
GYSRIGKPILCPVHPAEELRLFCEFCDRPVCRDCVVGEHREHPCDFTSNVIHKHGDSVWE
LLKGTQPHVEALEEALAQIHIMNSALQKQVEAVAADVRTFSEGYIKAIEEHRDKLLKQLE
DIRAQKENSLQLQKAQLEQLLADMRTGVEFTEHLLTSGSDLEILITKRVVVERLRKLNKV
QYSARPGVNDKIRFCPQEKAGQCRGYEIYGTINTKEVDPAKCVLQGEDLHRAREKQTASF
TLLCKDAAGEIMGRGGDNVQVAIVPKDKKDSPVRTMVQDNKDGTYYISYTPKEPGVYTVW
VCIKEQHVQGSPFTVTVRRKHRPHSGVFHCCTFCSSGGQKTARCACGGTMPGGYLGCGHG
HKGHPGHPHWSCCGKFNEKSECTWTGGQSTPRSLLRTVAL
Download sequence
Identical sequences A0A2I3TLJ8
ENSPTRP00000038900 XP_001145514.1.37143 9598.ENSPTRP00000038900 ENSPTRP00000038900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]