SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000042859 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000042859
Domain Number 1 Region: 84-371
Classification Level Classification E-value
Superfamily L domain-like 1.7e-51
Family Ngr ectodomain-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000042859   Gene: ENSPTRG00000022635   Transcript: ENSPTRT00000042963
Sequence length 382
Comment pep:known chromosome:CHIMP2.1.4:1:182287955:182305001:1 gene:ENSPTRG00000022635 transcript:ENSPTRT00000042963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSPLCWLLPLLILASVAQGQPTRRPRPGTGPGRRPRPRPRPTPSFPQPDEPAEPTDLPP
PLPPGPPSIFPDCPRECYCPPDFPSALYCDSRNLRKVPVIPPRIHYLYLQNNFITELPVE
SFQNATGLRWINLDNNRIRKIDQRVLEKLPGLVFLYMEKNQLEEVPSALPRNLEQLRLSQ
NHISRIPPGVFSKLENLLLLDLQHNRLSDGVFKPDTFHGLKNLMQLNLAHNILRKMPPRV
PTAIHQLYLDSNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLSH
NRISSVPAINNRLEHLYLNNNSIEKINGTQICPNDLVAFHDFSSDLENVPHLRYLRLDGN
YLKPPIPLDLMMCFRLLQSVVI
Download sequence
Identical sequences H2R1T6 P51888
ENSP00000343924 9598.ENSPTRP00000042859 9606.ENSP00000343924 NP_002716.1.87134 NP_002716.1.92137 NP_958505.1.87134 NP_958505.1.92137 XP_003823035.1.60992 XP_008974850.1.60992 XP_009439275.1.37143 XP_525032.2.37143 ENSP00000343924 ENSPTRP00000042859 ENSPTRP00000042859 ENSP00000343924 gi|41349454|ref|NP_958505.1| gi|4506041|ref|NP_002716.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]