SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000044315 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000044315
Domain Number 1 Region: 176-333
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 4.97e-67
Family DNA-binding protein LAG-1 (CSL) 0.000000856
Further Details:      
 
Domain Number 2 Region: 30-178
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.98e-66
Family DNA-binding protein LAG-1 (CSL) 0.0000107
Further Details:      
 
Domain Number 3 Region: 334-446
Classification Level Classification E-value
Superfamily E set domains 1.21e-41
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000044315   Gene: ENSPTRG00000015968   Transcript: ENSPTRT00000048176
Sequence length 500
Comment pep:known_by_projection chromosome:CHIMP2.1.4:4:26288793:26402697:1 gene:ENSPTRG00000015968 transcript:ENSPTRT00000048176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHTEGSPAEEPPAHAPSPGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSY
GNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGK
NYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLC
IASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDG
YIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCL
SQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESL
QLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQ
PVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGS
YTNASTNSTSVTSSTATVVS
Download sequence
Identical sequences A0A2I3SR34 Q06330
NP_005340.2.87134 NP_005340.2.92137 XP_001166354.1.37143 XP_016863661.1.92137 ENSPTRP00000044315 ENSP00000347659 ENSP00000345206 ENSP00000354528 9598.ENSPTRP00000044315 9606.ENSP00000345206 ENSPTRP00000044315 gi|42560227|ref|NP_005340.2| ENSP00000345206 ENSP00000354528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]