SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000046076 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000046076
Domain Number 1 Region: 432-820
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.61e-131
Family Ankyrin repeat 0.000000000335
Further Details:      
 
Domain Number 2 Region: 188-450
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.51e-73
Family Ankyrin repeat 0.000003
Further Details:      
 
Domain Number 3 Region: 32-222
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.06e-47
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 4 Region: 3566-3674
Classification Level Classification E-value
Superfamily DEATH domain 5.89e-25
Family DEATH domain, DD 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000046076   Gene: ENSPTRG00000016382   Transcript: ENSPTRT00000050131
Sequence length 3957
Comment pep:known_by_projection chromosome:CHIMP2.1.4:4:115703431:116066249:1 gene:ENSPTRG00000016382 transcript:ENSPTRT00000050131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMNEDAAQKSDSGEKFNGSSQRRKRPKKSDSNASFLRAARAGNLDKVVEYLKGGIDINTC
NQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEG
ANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVA
ILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIA
AHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGL
TPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDD
VTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKY
GASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVV
RCLLRNGARVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISARE
GQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPL
HVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTK
QGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGAD
QDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVL
LQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMT
EVLDVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLR
SFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQVSTLAKEAERNSYRLSWGTENLDNVALS
SSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPM
VEGEGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVE
IPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRIC
RIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQP
MHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRL
LCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYRE
IICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKP
IYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGL
VHQAICNLNITLPIYTKESESDQEQEEEIDMTSEKNDETESTETSVLKSHLVNEVPVLAS
PDLLSEVSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLE
KVNEILRSGTCTRDESSVQSSRSERGLVEEEWVIVSDEEIEEARQKAPLEITEYPCVEVR
IDKEIKGKVEKDSTGLVNYLTDDLNTYVPLPKEQLQTVQDKAGKKCEAPAVGRSSEKEGK
DIPPDETQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGED
PGLAPEPLPTVKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPIRVKGKEDVPKK
TTHRPHPAASPSLKSERHAPGSPSPKTERHSTLSSSAKTERHPPLSPSSKTEKHSPVSPS
AKTERHSPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSG
RTEKHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGKTEKHLPVSPSGKTEKQPPVSPTSK
TERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSAKQKQPQEKGKVRVEKEKGPILTQR
EAQKTENQTIKRGQRIPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVP
EEETHRESEVPKEKMADEQGDMDLQISPDRKTSTDFSEVIKQELEDNDKYQQFRLSEETE
KAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSLQSGALDGSSESLKNEGVAGSPCGSLME
GTPQISSEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHP
TTKDITGGSEERGATVTEDSETSTESFQKEATLGSPKDTSPKREDDCTGSCSVALAKETP
TGLTEEAACDEGQRTFGSSAHKTQTDSEAQESTATSDETKALPLPEASVKTDTGTESKPQ
GVIRSPQGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPL
KESPCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKTELLTEVASVRSRLLRDPDGSAEDD
SLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPKTTDVSTPKPAVIHECAEEDDSENGEKK
RFTPEEEMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHT
GSGEDESGVPVLVTSESRKVSSSSESEPELAQLKKGADSGLLPEPVIRVQPPSPLPSSMD
SNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKSEEEKDSESHLAEDSHAVSTEAEDRSYD
KLNRDTDQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEK
DTEGEELDVSRAESPQADCPSESFSSSSSLPHCSVSEGKELDEDISATSSIQKTEVTKTD
ETFENLPKDCPSQDSSITTQTDRFSMDVPVSDLAETDEIYDPQITSPYENVPSQSFFSSE
ESKTQTDANHTTSFHSSEVYSVTVTSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQE
STLWEMQSDSVSSSFEPTMSATTAVVGEQISKVIITKTDVDSDSWSEIREDDEAFEARVK
EEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGAIDMT
KRSYADESFHFFQIGQESREETLSEDVKEGATGAEPLPLETSAESLTLSESKETVDDEAD
LLPDDLSEEVEEIPASDAQLNSQMGISVSTETPTKEAVSVGTKDLPTVQTGDIPPLSGVK
QISCPDSSEPTVQVQLDFSTLTRSVYSDRGDDSPDSSPEEQKSVIEIPTAPMENVPSTES
KSKILVRTMPTSTPAPPSAEYESSVSEDFLSSVDEENKEDEAKPKSKLPVKVPLQRVEQQ
LSDLDTSVQKTVAPQGQDMTSIAPDNRSKSESDASSLDSKTKCPVKTRSYTETETESRER
AEELELESEEGATRPKILTSRLPVKSRSTTSSCRGATSPTKESKEHFFDLYRNSIEFFEE
ISDEASKLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWD
ESIETLIERIPDENGHDHAEDPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQ
IRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHLMETNTEPLQERI
SHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVG
YSTFQDGVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTE
ASETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQEPEEPSEHREESS
PQKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVT
RKIIRRYVSSEGTEKEEIMVQGMPQEPVNIEEGDGYSKVIKRVVLKSDTEQSEDNNE
Download sequence
Identical sequences ENSPTRP00000046076 ENSPTRP00000046076 9598.ENSPTRP00000046076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]