SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000047636 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000047636
Domain Number 1 Region: 95-179
Classification Level Classification E-value
Superfamily E set domains 0.00000000119
Family Filamin repeat (rod domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000047636   Gene: ENSPTRG00000004308   Transcript: ENSPTRT00000055192
Sequence length 544
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:112479132:112500196:-1 gene:ENSPTRG00000004308 transcript:ENSPTRT00000055192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKISMINYKSLLALLFILASWIIFAVFQNSTKVWSALNLSISLHYWNNSTKSLFPKTPLI
SLKPLTETELRIKEIIEKLDQQIPPRPFTHVNTTTSAAHSTATILNPRDTYCRGDQLHIL
LEVRDHLGRRKQYGGDFLRARMSSPALMAGASGKVTDFNNGTYLVSFTLFWEGQVSLSLL
LIHPSEGVSALWSARNQGYDRVIFIGQFVNGTSQVHSECGLILNTNAELCQYLDNRDQEG
FYCVRPQHMPCAALTHMYSKNKKVSYLSKQEKSLFERSNVGVEIMEKFNTISVSKCNKET
VAMKEKCKFGMTSTIPSGHVWRNTWNPVSCSLATVKMKECLRGKLIYLMGDSTIRQWMEY
FKASINTLKSVDLHESGKLQHQLAVDLDRNINIQWQKHCYPLIGSMTYSVKEMEYLTRAI
DRTGGEKNTVIVISLGQHFRPFPIDVFIRRALNVHKAIQHLLLRSPDTMVIIKTENIREM
YNDAERFSDFHGYIQYLIIKDIFQDLSVSIIDAWDITIAYGTNNVHPPQHVVGNQINILL
NYIC
Download sequence
Identical sequences H2R4Y5
9598.ENSPTRP00000047636 ENSPTRP00000047636 XP_016777517.1.37143 ENSPTRP00000047636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]