SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000053469 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000053469
Domain Number 1 Region: 2-540
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 5.23e-83
Family Acetyl-CoA synthetase-like 0.00002
Further Details:      
 
Domain Number 2 Region: 753-1094
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.92e-49
Family Quinoprotein alcohol dehydrogenase-like 0.01
Further Details:      
 
Domain Number 3 Region: 552-607
Classification Level Classification E-value
Superfamily ACP-like 0.0000589
Family Acyl-carrier protein (ACP) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000053469   Gene: ENSPTRG00000016079   Transcript: ENSPTRT00000029964
Sequence length 1097
Comment pep:known chromosome:CHIMP2.1.4:4:73600710:73652909:1 gene:ENSPTRG00000016079 transcript:ENSPTRT00000029964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLQELVHKAASCYMDRVAVCFDECNNQLPVYYTYKTVVNAASELSNFLLLHCDFQGIRE
IGLYCQPGIDLPSWILGILQVPAAYVPIEPDSPPSLSTHFMKKCNLKYILVEKKQINKFK
SFHETLLNYDTFTVEHNDLVLFRLHWKNTEVNLMLNDGKEKYEKEKIKSISSEHVNEEKA
EEHMDLRLKHCLAYVLHTSGTTGIPKIVRVPHKCIVPNIQHFRVLFDITQEDVLFLASPL
TFDPSVVEIFLALSSGASLLIVPTSVKLLPSKLSVLFSHHRVTVLQATPTLLRRFGSQLI
KSTVLSATTSLRVLALGGEAFPSLTVLRSWRGEGNKTQIFNVYGITEVSSWATIYRIPEK
TLNSTLKCELPVQLGFPLLGTVVEVRDTNGFTIQEGSGQVFLGGRNRVCFLDDEVTVPLG
TMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRLNIELVQQVAEELQQVESCAVTWYNQEK
LILFMVSKDASVKEYIFKELQKYLPSHAVPDELVLIDSLPLTSHGKIDVSELNKIYLNYI
NLKSENKLSGKEDLWEKLQYLWKSTLNLPEDLLRVPDESLFLNSGGDSLKSIRLLSEIEK
LVGTSVPGLLEIILSSSILEIYNHILQTVVPDEDVTFRKSCATKRKLSDINQEEASGTSL
HQKAIMTFTCQNEINAFVVLSRGSQILSLNSTRFLTKLGHCSSACPSDSVSQTNIQNLKD
LNSPVLIGKSKDPSCVAKVSEEGKPAIGPQKMELHVRWRSDTGKCVDASPLVVIPTFDKS
STTVYIGSHSHRMKAVDFYSGKVKWEQILGDRIESSACVSKCGNFIVVGCYNGLVYVLKS
NSGEKYWMFTTEDAVKSSATMDPTTGLIYIGSHDQHAYALDIYRKKCVWKSKCGGTVFSS
PCLNLIPHHLYFATLGGLLLAVNPATGNVIWKHSCGKPLFSSPRCCSQYICIGCVDGNLL
CFTHFGEQVWQFSTSGPIFSSPCTSPSEQKIFFGSHDCFIYCCNMKGHLQWKFETTSRVY
ATPFAFHNYNGSNEMLLAAASTDGKVWILESQSGQLQSVYELPGEVFSSPVVLESMLIIG
CRDNYVYCLDLLGGNQK
Download sequence
Identical sequences ENSPTRP00000053469 ENSPTRP00000053469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]