SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000055035 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000055035
Domain Number 1 Region: 25-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.8e-19
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000055035   Gene: ENSPTRG00000002858   Transcript: ENSPTRT00000062477
Sequence length 159
Comment pep:known chromosome:CHIMP2.1.4:10:100163921:100165166:-1 gene:ENSPTRG00000002858 transcript:ENSPTRT00000062477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTARGTPSRFLASVLHNGLGRYVQQLQRLSFSVSRDGASSRGAREFVEREVIDFARRNPG
VVIYVNSRPCCVPRVVAEYLNGAVREESIHCKSVEEISTLVQKLADQSGLDVIRIRKPFH
TDNPSIQGQWHPFTNKPTTFRGLRPREVQDPAPAQVQAQ
Download sequence
Identical sequences K7AAG0
NP_115488.2.87134 NP_115488.2.92137 XP_005270288.1.92137 XP_006718098.1.92137 XP_016774629.1.37143 XP_018890126.1.27298 ENSPTRP00000055035 ENSPTRP00000055035 ENSP00000315948 ENSP00000359256 gi|28872734|ref|NP_115488.2| hsi002025749.1 ENSP00000315948 ENSP00000359256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]