SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000059822 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000059822
Domain Number 1 Region: 1883-2161
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.99e-98
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000118
Further Details:      
 
Domain Number 2 Region: 568-755
Classification Level Classification E-value
Superfamily Fibronectin type III 1.68e-44
Family Fibronectin type III 0.00082
Further Details:      
 
Domain Number 3 Region: 1146-1331
Classification Level Classification E-value
Superfamily Fibronectin type III 5.08e-38
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 4 Region: 757-954
Classification Level Classification E-value
Superfamily Fibronectin type III 1.24e-37
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 5 Region: 296-347,431-555
Classification Level Classification E-value
Superfamily Fibronectin type III 7.04e-36
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 6 Region: 958-1143
Classification Level Classification E-value
Superfamily Fibronectin type III 4.01e-30
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 7 Region: 1329-1517
Classification Level Classification E-value
Superfamily Fibronectin type III 1.34e-29
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 8 Region: 55-108,168-294
Classification Level Classification E-value
Superfamily Fibronectin type III 2.5e-28
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 9 Region: 1534-1633
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000353
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 10 Region: 5-64
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000855
Family Fibronectin type III 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000059822   Gene: ENSPTRG00000039205   Transcript: ENSPTRT00000075228
Sequence length 2200
Comment pep:known_by_projection chromosome:CHIMP2.1.4:12:80446847:80687620:1 gene:ENSPTRG00000039205 transcript:ENSPTRT00000075228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTVYTQVRAKPDSLEVLLTNLNPGTTYEIKVAAENSAGIGLFSDPFLFQTAESAPGKVV
NLTVEAYNSSAVKLIWYLPRQPNGKITSFKISVKHARSGIVVKDVSIRVEDILTGKLPEC
NENSESFLWSTASPSPTLGRVTPPSRTTHSSRTLTQNGISSVWKEPISFVVTHLRPYTTY
LFEVSAVTTEAGYIDRTIVRTPESVPEGPPQNCVTGNITGKSFSILWDPPTIVTGKFSYR
VELYGPSGRILDNSTKELKFAFTNLTPFTMYDVYIAAETSAGTGPKSNISVFTPPDVPGA
VFDLQLAEVESTQVRITWKKPRQPNGIINQYRVKVLVPETGIILENTLLTGNNEYINDPM
APEIVNIVEPMVGLYEGSAEMSSDLHSLATFIYNSHPDKNFPARNRAEDQTSPVVTTRNQ
YITDIAAEQLSYVIRRLVPFTEHMIGVSAFTIMGEGPPTVLSVRTHQQVPSSIKIINYKN
ISSSSILLYWDPPEYPNGKITHYTIYAMELDTNRAFQITTIDNSFLITGLKKYAKYKMRV
AASTHVGESSLSEENDIFVRTSEDEPESSPQDVEVIDVTADEIRLKWSPPEKPNGIIIAY
EVLYKNIDTLYMKNTSTTDIILRNLRPHTLYNISVRSYTRFGHGNQVSSLLSVRTSETVP
DSAPENITYKNISSGEIELSFLPPSSPNGIIQKYTIYLKRSNGNEERTINTTSLTQNIKG
LKKYTQYIIEVSASTLKGEGVRSAPISILTEEDAPDSPPQDFSVKQLSGVTVKLSWQPPL
EPNGIILYYTVYVWNRSSLKTINVTETSLALSDLDYNVEYTAYVTASTRFGDGKTRSNII
SFQTPEGAPSDPPKDVYYANLSSSSIILFWTPPSKPNGIIQYYSVYYRNTSGTFMQNFTL
HEVTNDFDSMTVSTIIDKLTIFSYYTFWLTASTSVGNGNKSSDIIEVYTDQDIPEGLVGN
LTYESISSTAINVSWVPPAQPNGLVFYYVSLILQQTPRHVRPPLVTYERSIYFDNLEKYT
DYILKITPSTEKGFSDTYTAQLYIKTEEDVPETSPIINTFKNLSSTSVLLSWDPPVKPNG
AIISYDLTLQGPNENYSFITSDNYIILEELSPFTLYSFFAAARTRKGLGPSSILFFYTDE
SVPLAPPQNLTLINCTSDFVWLKWSPSPLPGGIVKVYSFKIHEHETDTIYYKNISGFKTE
AKLVGLEPVSTYSIRVSAFTKVGNGNQFSNVVKFTTQESVPDVVQNMQCMATSWQSVLVK
WDPPKKANGIITQYMITVERNSTKVSPQDHMYTFIKLLANTSYVFKVRASTSAGEGDEST
CHVSTLPETVPSVPTNIAFSDVQSTSATLTWIRPDTILGYFQNYKITTQLRAQKCKEWES
EECVEYQKIQYLYEAHLTEETVYGLKKFRWYRFQVAASTNAGYGNASNWISTQTLPGPPD
GPPENVHVVATSPFSISISWSEPAVITGPTCYLIDVKSVDNDEFNISFIKSNEENKTIEI
KDLEIFTRYSVVITAFTGNISAAYVEGKSSAEMIVTTLESAPKDPPNNMTFQKIPDEVTK
FQLTFLPPSQPNGNIQVYQALVYREDDPTAVQIHNLSIIQKTNTFVIAVLEGLKGGHTYN
ISVYAVNSAGAGPKVPMRITMDIKAPARPKTKPTPIYDATGKLLVTSTTITIRMPICYYS
DDHGPIKNVQVLVTETGAQHDGNVTKWYDAYFNKARPYFTNEGFPNPPCTEEKTKFSGNE
EIYIIGADNACMIPGNEDKICNGPLKPKKQYLFKFRATNIMGQFTDSDYSDPVKTLGEGL
SERTVEIILSVTLCILSIILLGTAIFAFARIRQKQKEGGTYSPQDAEIIDTKLKLDQLIT
VADLELKDERLTRLLSYRKSIKPISKKSFLQHVEELCTNNNLKFQEEFSELPKFLQDLSS
TDADLPWNRAKNRFPNIKPYNNNRVKLIADASVPGSDYINASYISGYLCPNEFIATQGPL
PGTVGDFWRMVWETRAKTLVMLTQCFEKGRIRCHQYWPEDNKPVTVFGDIVITKLMEDVQ
IDWTIRDLKIERHGDCMTVRQCNFTAWPEHGVPENSAPLIHFVKLVRASRAHDTTPMIVH
CSAGVGRTGVFIALDHLTQHINDHDFVDIYGLVAELRSERMCMVQNLAQYIFLHQCILDL
LSNKGSNQPICFVNYSALQKMDSLDAMEGDVELEWEETTM
Download sequence
Identical sequences ENSPTRP00000059822 ENSPTRP00000059822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]