SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060364 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060364
Domain Number 1 Region: 239-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.52e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 3-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-24
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 295-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.82e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 5 Region: 183-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.86e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 396-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.27e-20
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 7 Region: 127-183
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.13e-17
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 8 Region: 101-140
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000162
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060364   Gene: ENSPTRG00000042406   Transcript: ENSPTRT00000073079
Sequence length 456
Comment pep:known_by_projection chromosome:CHIMP2.1.4:10:38494031:38508828:-1 gene:ENSPTRG00000042406 transcript:ENSPTRT00000073079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKFQGPVTLKDVIVEFTKEEWKLLTPAQRTLYKDVMLENYSHLVSVGYHVNKPNAVFKL
KQGKEPWILEVEFPHRGFPEDLWSIHDLEARYQESQAGNSRNGELTKHQKTRTTEKACEC
KECGKFFCQKSALIVHQHTHSKGKSYDCDKCGKSFSKNEDLIRHQKIHTRDKTYECKECK
KIFYHLSSLSRHLRTHAGEKPYECNQCEKSFYQKPHLIEHQKTHTGEKPFECTECGKFFY
VKAYLMVHQKTHTGEKPYECKECGKAFSQKSHLTVHQRMHTGEKPYKCKECGKFFSRNSH
LKTHQRTHTGEKPYECKECRKCFYQKSALTVHQRTHTGEKPFECNKCGKTFYYKSDLTKH
QRKHTGEKPYECIECGKSFAVNSVLRLHQRTHTGEKPYACKECGKSFSQKSHFIIHQRKH
TGEKPYECQECGETFIQKSQLTAHQKTHTKKRKAEK
Download sequence
Identical sequences A0A2I3TWI2
ENSPTRP00000060364 XP_008965802.1.60992 XP_008965803.1.60992 XP_009456564.1.37143 XP_521677.2.37143 ENSPTRP00000060364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]