SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002666 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002666
Domain Number 1 Region: 25-169
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.45e-31
Family Dual specificity phosphatase-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002666   Gene: ENSPTRG00000001594   Transcript: ENSPTRT00000002905
Sequence length 340
Comment pep:known chromosome:CHIMP2.1.4:1:140000317:140008033:1 gene:ENSPTRG00000001594 transcript:ENSPTRT00000002905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEAPGPSDGCELSNPSASRVSCAGQMLEVQPGLYFGGAAAVAEPDHLREAGITAVLTVD
SEEPSFKAGPGVEDLWRLFVPALDKPETDLLSHLDRCVAFIGQARAEGRAVLVHCHAGVS
RSVAIITAFLMKTDQLPFEKAYEKLQILKPEAKMNEGFEWQLKLYQAMGYEVDTSSAIYK
QYRLQKVTEKYPELQNLPQELFAVDPTTVSQGLKDEVLYKCRKCRRSLFRSSSILDHREG
SGPIAFAHKRMTPSSMLTTGRQAQCTSYFIEPVQWMESALLGVMDGQLLCPKCSAKLGSF
NWYGEQCSCGRWITPAFQIHKNRVDEMKILPVLGSQTGKI
Download sequence
Identical sequences H2Q0H2 Q9UNI6
NP_009171.1.87134 NP_009171.1.92137 ENSP00000356920 9598.ENSPTRP00000002666 9606.ENSP00000356920 ENSPTRP00000002666 NYSGXRC-8664a hsi002006325.1 ENSP00000356920 ENSP00000356920 ENSPTRP00000002666 gi|6005956|ref|NP_009171.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]