SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003034 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003034
Domain Number 1 Region: 630-910
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.44e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000282
Further Details:      
 
Domain Number 2 Region: 920-1225
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.44e-83
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000045
Further Details:      
 
Domain Number 3 Region: 389-562
Classification Level Classification E-value
Superfamily Fibronectin type III 1.72e-20
Family Fibronectin type III 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003034   Gene: ENSPTRG00000001817   Transcript: ENSPTRT00000003297
Sequence length 1304
Comment pep:known chromosome:CHIMP2.1.4:1:177359410:177478533:1 gene:ENSPTRG00000001817 transcript:ENSPTRT00000003297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLWLKLLAFGFAFLDTEVFVTGQSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPAST
FERENDFLETTTSLSPDNTSTQVSPDSLDNASAFNTTGVSSVQTPHLPTHADSQTPSAGT
DTQTFSGSAANAKLNPTPGSNAISDVPGERSTASTFPTDPVSPLTTTLSLAHHSSAALPA
RTSNTTITANTSDAYLNASETTTLSPSGSAVISTTTIATTPSKPTCDEKYANITVDYLYN
KETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNMSVSISHNSCTAPDKTLLLDVPPG
VEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNTTSDNKEIKLQNLDPE
HEYKCDSEILYNNHKYTNASKIIKTDFGTPGQPQNITCRSEAAHQGVITWNPPQRSFHNF
TLCYMKETEKNCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIVAKVQRNGSAATCHFTTKS
APPSQVWNMTVSMTSDNSMHVKCRPPRDRNGPHERYHLEVEAGNTLVRNESHKNCDFRVK
DLQYSTDYTFKAYFHNGDYPGEPFILHQSTSYNSKALIAFLAFLIVVTSIALLVVLYKIY
DLHKKRSCNLDEQQELVERDDEKQLMNVEPIHADILLETYKRKIADEGRLFLAEFQSIPR
VFSKFPIKEARKPFNQNKNRYVDILPYDYNRVELSEINGDAGSNYINASYIDGFKEPRKY
IAAQGPRDETVDDFWRMIWEQKATVIVMVTRCEEGNRNKCAEYWPSMEEGTRAFGDVVVK
INQHKRCPDYIIQKLNIVNKKEKATGREVTHIQFTSWPDHGVPEDPHLLLKLRRRVNAFS
NFFSGPIVVHCSAGVGRTGTYIGIDAMLEGLEAENKVDVYGYVVKLRRQRCLMVQVEAQY
ILIHQALVEYNQFGETEVNLSELHPYLHNMKKRDPPSEPSPLEAEFQRLPSYRSWRTQHI
GNQEENKSKNRNSNVIPYDYNRVPLKHELEMSKESEHDSDESSDDDSDSEEPSKYINASF
IMSYWKPEVMIAAQGPLKETIGDFWQMIFQRKVKVIVMLTELKHGDQEICAQYWGEGTQT
YGDIEVDLKDTDKSSTYTLRVFELRHSKRKDSRTVYQYQYTNWSVEQLPAEPKELISMIQ
VVKQKLPQKNSSEGNKHHKSTPLLIHCRDGSQQTGIFCALLNLLESAETEEVVDIFQVVK
ALRKARPGMVSTFEQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVKQDANCV
NPLGAPEKLPEAKEQAEGSEPTSGTEGPEHSVNGPASPALNQGS
Download sequence
Identical sequences ENSPTRP00000003034 ENSPTRP00000003034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]