SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003091 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003091
Domain Number 1 Region: 126-390
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.01e-88
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003091   Gene: ENSPTRG00000001848   Transcript: ENSPTRT00000003356
Sequence length 399
Comment pep:known chromosome:CHIMP2.1.4:1:180928260:180941064:-1 gene:ENSPTRG00000001848 transcript:ENSPTRT00000003356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGASFWPIRQAREQQRRALSFRQTSWLSEPPLGPAPHPSMVQAHGGRSRAQPLTLSLGAA
MTQPPPAKTPAKKHVRLQERRGSNVALMLDVRSLGAVEPICSVNTPREVTLHFLRTAGHP
LTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGRA
QSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGK
EKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQYQEERRSVKHILFSAWPDHQTP
ESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGCFIATRIGCQQLKARGEVDILG
IVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
Download sequence
Identical sequences A0A2J8QWN2
ENSPTRP00000003091 XP_014197762.1.60992 ENSPTRP00000003091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]