SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003322 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003322
Domain Number 1 Region: 881-1183
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.25e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000123
Further Details:      
 
Domain Number 2 Region: 213-356
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-30
Family Third domain of FERM 0.0067
Further Details:      
 
Domain Number 3 Region: 105-212
Classification Level Classification E-value
Superfamily Second domain of FERM 9.55e-29
Family Second domain of FERM 0.00042
Further Details:      
 
Domain Number 4 Region: 18-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.37e-20
Family First domain of FERM 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003322   Gene: ENSPTRG00000001976   Transcript: ENSPTRT00000003606
Sequence length 1187
Comment pep:known chromosome:CHIMP2.1.4:1:193511663:193705796:-1 gene:ENSPTRG00000001976 transcript:ENSPTRT00000003606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETH
YFGLWFLSKSQQARWVELEKPLKKHLDKFANEPLLFFGVMFYVPNVSWLQQEATRYQYYL
QVKKDVLEGRLRCTLDQVIRLAGLAVQADFGDYNQFDSQDFLREYVLFPMDLALEEAVLE
ELTQKVAQEHKAHSGILPAEAELMYINEVERLDGFGQEIFPVKDNHGNCVHLGIFFMGIF
VRNRIGRQAVIYRWNDMGNITHNKSTILVELINKEETALFHTDDIENAKYISRLFATRHK
FYKQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPVHVQCGEHYSETHTSQDSIFH
GNEEALYCNSHNSLDLNYLNGTVTNGSVCSVHSVNSLNCSQSFIQASPVSSNLSIPGSDI
MRADYIPSHRHSAIIVPSYRPTPDYETVMRQMKRGILHTDSQSQSLRNLNIINAHAYNQP
EDLVYSQPEMRERHPYTVPYGPQGVYSNKLVSPSDQRNPKNNVVPSKPGASTISHTVSTP
ELANMQLQGSHNYSTAHMLKNYLFRPPPPYPRPRPATSTPDLASHRHKYVSGSSPDLVTR
KVQLSVKTFQEDSSPVVHQSLQEVSEPLTATKHHGTVNKRHSLEVMNSMVRGMEAMTLKS
LHLPMARRNMLREQGPPEEGSGSHEVPQLPQYHHKKTFSDATMLIHSSESEEEEEEAPES
VPQIPMLREKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQASLPPAMARARV
LRHGPAKAISVSRTDPPAVNGASLGPSISEPDLTSVKERVKKEPVKERPVSEMFSLEDSI
IEREMMIRNLEKQKMAGLEAQKRPLMLAALNGLSVARVSGREENRVDATRVPMDERFRTL
KKKLEEGMVFTEYEQIPKKKANGIFSTAALPENAERSRIREVVPYEENRVELIPTKENNT
GYINASHIKVVVGGAEWHYIATQGPLPHTCHDFWQMVWEQGVNVIAMVTAEEEGGRTKSH
RYWPKLGSKHSSATYGKFKVTTKFRTDSVCYATTGLKVKHLLSGQERTVWHLQYTDWPDH
GCPEDVQGFLSYLEEIQSVRRHTNSMLEGTKNRHPPIVVHCSAGVGRTGVLILSELMIYC
LEHNEKVEVPMMLRLLREQRMFMIQTIAQYKFVYQVLIQFLQNSRLI
Download sequence
Identical sequences K7APV6
ENSPTRP00000003322 ENSPTRP00000003322 9598.ENSPTRP00000003322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]