SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003359 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003359
Domain Number 1 Region: 255-408
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.4e-43
Family Dual specificity phosphatase-like 0.000061
Further Details:      
 
Domain Number 2 Region: 86-231
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.8e-24
Family Cell cycle control phosphatase, catalytic domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003359   Gene: ENSPTRG00000002005   Transcript: ENSPTRT00000003644
Sequence length 427
Comment pep:known chromosome:CHIMP2.1.4:1:200742902:200971813:-1 gene:ENSPTRG00000002005 transcript:ENSPTRT00000003644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPSPLDDRVVVALSRPVRPQDLNLCLDSSYLGSATPGSNSHPPVITTTAIGTSTTCPAN
QMVNNNENTGSLSPSSGVGSPVSGTPKQLASIKIIYPNDLAKKMTKCSKSHLPSQGPVII
DCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIV
YDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLCDNSLQLQECRE
VGGGASAASSLLPQPIPTTPDIENAELTPILPFLFLGNEQDAQDLDTMQRLNIGYVINVT
THLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRS
ATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPRILTPKL
MGVETVV
Download sequence
Identical sequences ENSPTRP00000003359 ENSPTRP00000003359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]