SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000004492 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000004492
Domain Number 1 Region: 55-333
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.06e-29
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.076
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000004492
Domain Number - Region: 438-518
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.000332
Family Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000004492   Gene: ENSPTRG00000002594   Transcript: ENSPTRT00000004871
Sequence length 518
Comment pep:known chromosome:CHIMP2.1.4:10:69034985:69049272:1 gene:ENSPTRG00000002594 transcript:ENSPTRT00000004871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTTASTAQQTVSAGTPFEGLQGSGTMDSRHSVSVHSFQTTSLHNSKAKSIIPNKVAPVV
ITYNCKEEFQIHDELLKAHYTLGRLSDNTPEHYLVQGRYFLVRDVTEKMDVLGTVGSCGA
PNFRQVQGGLTVFGMGQPSLSGFRRVLQKLQKDGHRECVIFCVREEPVLFLRADEDFVSY
TPRDKQNLHENLQGLGPRVRVESLELAIRKEIHDFAQLSENTYHVYHNTEDLRGEPHAVA
IRGEDDLHVTEEVYKRPLFLQPTYRYHRLPLPEQGSPLEAQLDAFVSVLRETPSLLQLRD
AHGPPPALVFSCQMGMGRTNLGMVLGTLILLHRSGTTSQPEAAPTQAKPLPMEQFQVIQS
FLRMVPQGRRMVEEVDRAITACAELHDLKEVVLENQKKLEGIRPESPAQVRRQRHSIWQR
GCELERLLLILNYYLHEQYPLAFALSFSRWLCAHPELYRLPVTLSSAGPVAPRDLIARGS
LREDDLVSPDALSTVREMDVANFRRVPRMPIYGTAQPS
Download sequence
Identical sequences ENSPTRP00000004492 ENSPTRP00000004492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]