SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000005972 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000005972
Domain Number 1 Region: 269-557
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.71e-87
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000005972   Gene: ENSPTRG00000003430   Transcript: ENSPTRT00000006475
Sequence length 565
Comment pep:known chromosome:CHIMP2.1.4:11:18512439:18578110:-1 gene:ENSPTRG00000003430 transcript:ENSPTRT00000006475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYEGARSERENHAADDSEGGALDMCCSERLPGLPQPIVMEALDEAEGLQDSQREMPPPP
PPSPPSDPAQKPPPRGAGSHSLTVRSSLCLFAASQFLLACGVLWFSGYGHIWSQNTTNLV
SSLLTLLKQLEPTAWLDSGTWGVPSLLLVFLSVGLVLVTTLVWHLLRTPLEPPTPLPPED
RRQSVSRQPSFTYSEWMEEKIEDDFLDLDPVPETPVFDCVMDIKPEADPTSLTVKSMGLQ
ERRGSNVSLTLDMCTPGCNEEGFGYLMSPREESAREYLLSASRVLQAEELHEKALDPFLL
QAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIR
GYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYD
GVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEE
AAQQEGPHCAPIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQ
TCEQYQFVHHVMSLYEKQLSHQSPE
Download sequence
Identical sequences H2Q3A1
ENSPTRP00000005972 XP_003312997.1.37143 XP_003312998.1.37143 XP_016776042.1.37143 ENSPTRP00000005972 9598.ENSPTRP00000005972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]