SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008040 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000008040
Domain Number 1 Region: 142-301
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.58e-44
Family Dual specificity phosphatase-like 0.000095
Further Details:      
 
Domain Number 2 Region: 10-140
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 6.29e-26
Family Cell cycle control phosphatase, catalytic domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008040   Gene: ENSPTRG00000004704   Transcript: ENSPTRT00000008701
Sequence length 665
Comment pep:known chromosome:CHIMP2.1.4:12:12736809:12826088:-1 gene:ENSPTRG00000004704 transcript:ENSPTRT00000008701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHEMTGTQIVTERLVALLESGTEKVLLIDSRPFVEYNTSHILEAININCSKLMKRRLQQ
DKVLITELIQHSAKHKVDIDCSQKVVVYDQSSQDVASLSSDCFLTVLLGKLEKSFNSVHL
LAGGFAEFSRCFPGLCEGKSTLVPTCISQPCLPVANIGPTRILPNLYLGCQRDVLNKELM
QQNGIGYVLNASNTCPKPDFIPESHFLRVPVNDSFCEKILPWLDKSVDFIEKAKASNGCV
LVHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPTISPNFNFLGQLLDYEKKIKN
QTGASGPKSKLKLLHLEKPNEPVPAVSEGGQKSETPLSPPCADSATSEAAGQRPVHPASV
PSVPSVQPSLLEDSPLVQALSGLHLSADRLEDSNKLKRSFSLDIKSVSYSASMAASLHGF
SSSEDALEYYKPSTTLDGTNKLCQFSPVQELSEQTPETSPDKEEASIPKKPQTTRPSDSQ
SKRLHSVRTSSSGTSQRSLLSPLHRSGSVEDNYHTSFLFGLSTSQQHLTKSAGLGLKGWH
SDILAPQTSTPSLTSSWYFATESSHFYSASAIYGGSASYSAYSCSQLPTCGDQVYSVRRR
QKPSDRADSRRSWHEESPFEKQFKRRSCQMEFGESIMSENRSREELGKVGSQSSFSGSME
IIEVS
Download sequence
Identical sequences H2Q5H0
9598.ENSPTRP00000008040 XP_003826596.1.60992 XP_009423146.1.37143 XP_016778472.1.37143 XP_016778473.1.37143 XP_016778474.1.37143 XP_016778475.1.37143 XP_016778476.1.37143 XP_520751.2.37143 ENSPTRP00000008040 ENSPTRP00000008040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]