SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000009743 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000009743
Domain Number 1 Region: 123-503
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.65e-146
Family Myotubularin-like phosphatases 0.0000000269
Further Details:      
 
Domain Number 2 Region: 6-112
Classification Level Classification E-value
Superfamily PH domain-like 9.63e-18
Family GRAM domain 0.043
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000009743
Domain Number - Region: 494-543
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 0.0199
Family MED7 hinge region 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000009743   Gene: ENSPTRG00000005718   Transcript: ENSPTRT00000010532
Sequence length 621
Comment pep:known chromosome:CHIMP2.1.4:13:24789487:24832698:-1 gene:ENSPTRG00000005718 transcript:ENSPTRT00000010532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHIRTTKVEQVKLLDRFSTSNKSLTGTLYLTATHLLFIDSHQKETWILHHHIASVEKLA
LTTSGCPLVIQCKNFRTVHFIVPRERDCHDIYNSLLQLSKQAKYEDLYAFSYNPKQNDSE
RLQGWQLIDLAEEYKRMGVPNSHWQLSDANRDYKICETYPRELYVPRIASKPIIVGSSKF
RSKGRFPVLSYYHQDKEAAICRCSQPLSGFSARCLEDEHLLQAISKANPVNRYMYVMDTR
PKLNAMANRAAGKGYENEDNYSNIRFQFVGIENIHVMRSSLQKLLEVNGTKGLSVNDFYS
GLESSGWLRHIKAVMDAAIFLAKAITVENASVLVHCSDGWDRTSQVCSLGSLLLDSYYRT
IKGFMVLIEKDWISFGHKFSERCGQLDGDPKEVSPVFTQFLECVWHLTEQFPQAFEFSEA
FLLQIHEHIHSCQFGNFLGNCQKEREELKLKEKTYSLWPFLLEDQKKYLNPLYSSESHRF
TVLEPNTVSFNFKFWRNMYHQFDRTLHPRQSVFNIIMNMNEQNKQLEKDIKDLESKIKQR
KNKQTDGVLTKELLHSVHPESPNLKTSLCFKEQTLLPVNDALRTIEGSSPADNRYSEYAE
EFSKSEPAVVSLEYGVARMTC
Download sequence
Identical sequences K7CJV1
ENSPTRP00000009743 9598.ENSPTRP00000009743 ENSPTRP00000009743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]