SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000011718 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000011718
Domain Number 1 Region: 222-562,643-667
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.15e-93
Family Myotubularin-like phosphatases 0.00000646
Further Details:      
 
Domain Number 2 Region: 35-180
Classification Level Classification E-value
Superfamily PH domain-like 7.5e-27
Family GRAM domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000011718   Gene: ENSPTRG00000006858   Transcript: ENSPTRT00000012659
Sequence length 778
Comment pep:known scaffold:CHIMP2.1.4:GL392258.1:186851:239528:-1 gene:ENSPTRG00000006858 transcript:ENSPTRT00000012659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLKPPKPTFRSYLLPPPQTDDKINSEPKIKKLEPVLLPGEIVVNEVNFVRKCIATDTS
QYDLWGKLICSNFKISFITDDPMPLQKFHYRNLLLGEHDVPLTCIEQIVTVNDHKRKQKV
LGPNQKLKFNPTELIIYCKDFRIVRFRFDESGPESAKKVCLAIAHYSQPTDLQLLFAFEY
VGKKYHNSANKINGIPSGDGGGGGGGGGNGAGGGSSQKTPLFETYSDWDREIKRTGASGW
RVCSINEGYMISTCLPEYIVVPSSLADQDLKIFSHSFVGRRMPLWCWSHSNGSALVRMAL
IKDVLQQRKIDQRICNAITKSHPQRSDVYKSDLDKTLPNIQEVQAAFVKLKQLCVNEPFE
ETEEKWLSSLENTRWLEYVRAFLKHSAELVYMLESKHLSVVLQEEEGRDLSCCVASLVQV
MLDPYFRTITGFQSLIQKEWVMAGYQFLDRCNHLKRSEKESPLFLLFLDATWQLLEQYPA
AFEFSETYLAVLYDSTRISLFGTFLFNSPHQRVKQSTEFAISKNIQLGDEKGLKFPSVWD
WSLQFTAKDRTLFHNPFYIGKSTPCIQNGSVKSFKRTKKSYSSTLRGMPSALKNGIISDQ
ELLPRRNSLILKPKPDPAQQTDSQNSDTEQYFREWFSKPANLHGVILPRVSGTHIKLWKL
CYFRWVPEAQISLGGSITAFHKLSLLADEVDVLSRMLRQQRSGPLEACYGELGQSRMYFN
ASGPHHTDTSRTPEFLSSSFPFSPVGNLCRRSILGTPLSKFLSGAKIWLSTETLANED
Download sequence
Identical sequences A0A2I3TA06
XP_003318095.1.37143 ENSPTRP00000011718 ENSPTRP00000011718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]