SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016771 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016771
Domain Number 1 Region: 898-1205
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-103
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000914
Further Details:      
 
Domain Number 2 Region: 1166-1464
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-82
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000813
Further Details:      
 
Domain Number 3 Region: 22-183
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-42
Family MAM domain 0.0000000165
Further Details:      
 
Domain Number 4 Region: 383-577
Classification Level Classification E-value
Superfamily Fibronectin type III 1.61e-28
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 5 Region: 281-414
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000213
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 6 Region: 190-288
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000835
Family I set domains 0.0000147
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000016771
Domain Number - Region: 596-633,686-734
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0288
Family Fibronectin type III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016771   Gene: ENSPTRG00000009851   Transcript: ENSPTRT00000018101
Sequence length 1466
Comment pep:known chromosome:CHIMP2.1.4:18:8200496:9027717:-1 gene:ENSPTRG00000009851 transcript:ENSPTRT00000018101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLGTCLATLAGLLLTAAGETFSGGCLFDEPYSTCGYSQSEGDDFNWEQVNTLTKPTSD
PWMPSGSFMLVNASGRPEGQRAHLLLPQLKENDTHCIDFHYFVSSKSNSPPGLLNVYVKV
NNGPLGNPIWNISGDPTRTWNRAELAISTFWPNFYQVIFEVITSGHQGYLAIDEVKVLGH
PCTRTPHFLRIQNVEVNAGQFATFQCNAIGRTVAGDRLWLQGIDVRDAPLKEIKVTSSRR
FIASFNVVNTTKRDAGKYRCMIRTEGGVGISNYAELVVKEPPVPIAPPQLASVGATYLWI
QLNANSINGDGPIVAREVEYCTASGSWNDRQPVDSTSYKIGHLDPDTEYEISVLLTRPGE
GGTGSPGPALRTRTKCADPMRGPRKLEVVEVKSRQITIRWEPFGYNVTRCHSYNLTVHYC
YQVGGQEQVREEVSWDTENSHPQHTITNLSPYTNVSVKLILMNPEGRKESQELIVQTDED
LPGAVPIESIQGSTFEEKIFLQWREPTQTYGVITLYEITYKAVSSFDPEIDLSNQSGRVS
KLGNETHFLFFGLYPGTTYSFTIRASTAKGFGPPATNQFTTKISAPSMPAYELETPLNQT
DNTVTVMLKPAHSRGAPVSVYQIVVEEERPRRTKKTTEILKCYPVPIHFQNASLLNSQYY
FAAEFPADSLQAAQPFTIGDNKTYNGYWNTPLLPYKSYRIYFQAASRANGETKIDCVQVA
TKGAATPKPVPEPEKQTDHTVKIAGVIAGILLFVIIFLGVVLVMKKRKLAKKRKETMSST
RQEMTVMVNSMDKSYAEQGTNCDEAFSFMDTHNLNGRSVSSPSSFTMKTNTLSTSVPNSY
YPDPFVPTAILDFSLNNETHTMASDTSSLVQSHTYKKREPADVPYQTGQLHPAIRVADLL
QHITQMKCAEGYGFKEEYESFFEGQSAPWDSAKKDENRMKNRYGNIIAYDHSRVRLQTIE
GDTNSDYINGNYIDGYHRPNHYIATQGPMQETIYDFWRMVWHENTASIIMVTNLVEVGRV
KCCKYWPDDTEIYKDIKVTLIETELLAEYVIRTFAVEKRGVHEIREIRQFHFTGWPDHGV
PYHATGLLGFVRQVKSKSPPSAGPLVVHCSAGAGRTGCFIVIDIMLDMAEREGVVDIYNC
VRELRSRRVNMVQTEEQYVFIHDAILEACLCGDTSVPASQVRSLYYDMNKLDPQTNSSQI
KEEFRTLNMVTPTLRVEDCSIALLPRNHEKNRCMDILPPDRCLPFLITIDGESSNYINAA
LMDSYKQPSAFIVTQHPLPNTVKDFWRLVLDYHCTSVVMLNDVDPAQLCPQYWPENGVHR
HGPIQVEFVSADLEEDIISRIFRIYNAARPQDGYRMVQQFQFLGWPMYRDTPVSKRSFLK
LIRQVDKWQEEYNGGEGRTVVHCLNGGGRSGTFCAISIVCEMLRHQRTVDVFHAVKTLRN
NKPNMVDLLDQYKFCYEVALEYLNSG
Download sequence
Identical sequences ENSPTRP00000016771 ENSPTRP00000016771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]