SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016819 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016819
Domain Number 1 Region: 9-291
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.26e-99
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016819   Gene: ENSPTRG00000009884   Transcript: ENSPTRT00000018156
Sequence length 415
Comment pep:known chromosome:CHIMP2.1.4:18:3646431:3737356:1 gene:ENSPTRG00000009884 transcript:ENSPTRT00000018156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNAENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKES
VKCAQYWPTDDQELLFKETGFSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGD
DINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKRWKELSKEDLSPA
FDHSPNKIITEKYNGNRIGLEEEKLTGDRYTGLSSKMQDTMEENSESALRKRIREDRKAT
TAQKVQQMKQRLNENERKRKRWLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL
Download sequence
Identical sequences K7C2Y4
ENSPTRP00000016819 ENSPTRP00000016819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]