SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017562 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017562
Domain Number 1 Region: 1376-1688
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.05e-112
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000118
Further Details:      
 
Domain Number 2 Region: 1647-1945
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.26e-103
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000157
Further Details:      
 
Domain Number 3 Region: 331-525
Classification Level Classification E-value
Superfamily Fibronectin type III 1.62e-44
Family Fibronectin type III 0.00041
Further Details:      
 
Domain Number 4 Region: 523-720
Classification Level Classification E-value
Superfamily Fibronectin type III 1.71e-43
Family Fibronectin type III 0.00063
Further Details:      
 
Domain Number 5 Region: 718-917
Classification Level Classification E-value
Superfamily Fibronectin type III 1.51e-28
Family Fibronectin type III 0.00037
Further Details:      
 
Domain Number 6 Region: 31-125
Classification Level Classification E-value
Superfamily Immunoglobulin 7.07e-18
Family I set domains 0.0043
Further Details:      
 
Domain Number 7 Region: 922-1030
Classification Level Classification E-value
Superfamily Fibronectin type III 3.3e-17
Family Fibronectin type III 0.00094
Further Details:      
 
Domain Number 8 Region: 135-227
Classification Level Classification E-value
Superfamily Immunoglobulin 3.45e-16
Family I set domains 0.018
Further Details:      
 
Domain Number 9 Region: 243-337
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000002
Family I set domains 0.01
Further Details:      
 
Domain Number 10 Region: 1037-1159
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000911
Family Fibronectin type III 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017562   Gene: ENSPTRG00000010328   Transcript: ENSPTRT00000018975
Sequence length 1948
Comment pep:known chromosome:CHIMP2.1.4:19:5232823:5369847:-1 gene:ENSPTRG00000010328 transcript:ENSPTRT00000018975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPTWGPGMVSVVGPMGLLVVLLVGGCAAEEPPRFIKEPKDQIGVSGGVASFVCQATGDP
KPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHA
KLTVLREDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSAS
NGRIKQLRSETFESTPIRGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRELREV
RRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGRNVLEL
TDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPMVTENTATSITITWDSGNPDPV
SYYVIEYKSKSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTR
TGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNV
DDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEARSETS
ITLSWSPPRQESIIKYELLFREGDHGREVGRTFDPTTSYVVEDLKPNTEYAFRLAARSPQ
GLGAFTPVVRQRTLQSKPSAPPQDVKCVSVRSTAILVSWRPPPPETHNGALVGYSVRYRP
LGSEDPEPKEVNGIPPTTTQILLEALEKWTQYRITTVAHTEVGPGPESSPVVVRTDEDVP
SAPPRKVEAEALNATAIRVLWRSPAPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDVMLA
DAQWETDDTAEYEMVITNLQPETAYSITVAAYTMKGDGARSKPKVVVTKGAVLGRPTLSV
QQTPEGSLLARWEPPAGTVEDQVLGYRLQFGREDSTPLATLEFPPSEDRYTASGVHKGAT
YVFRLAARSRGGLGEEAAEVLSIPEDTPRGHPQILEAAGNASAGTVLLRWLPPVPAERNG
AIVKYTVAVREAGALGPARETELPAAAEPGAENVLTLQGLKPDTAYDLQVRAHTRRGPGP
FSPPVRYRTFLRDQVSPKNFKVKMIMKTSVLLSWEFPDNYNSPTPYKIQYNGLTLDVDGR
TTKKLITHLKPHTFYNFVLTNRGSSLGGLQQTVTAWTAFNLLNGKPSVAPKPDADGFIMV
YLPDGQSPVPVQSYFIVMVPLRKSRGGQFLTPLGSPEDMDLEELIQDISRLQRRSLRHSR
QLEVPRPYIAARFSVLPPTFHPGDQKQYGGFDNRGLEPGHRYVLFVLAVLQKSEPTFAAS
PFSDPFQLDNPDPQPIVDGEEGLIWVIGPVLAVVFIICIVIAILLYKNKPDSKRKDSEPR
TKCLLNNADLAPHHPKDPVEMRRINFQTPDSGLRSPLREPGFHFESMLSHPPIPIADMAE
HTERLKANDSLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILQPIEG
IVGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIK
CDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGV
PEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGH
VTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQVEPGEHVTGM
ELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASF
IDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSA
RYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFI
GQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRP
AMVQTEDEYQFCYQAALEYLGSFDHYAT
Download sequence
Identical sequences H2QF28
XP_003316068.1.37143 XP_009432718.1.37143 ENSPTRP00000017562 ENSPTRP00000017562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]