SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019771 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019771
Domain Number 1 Region: 796-1077
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.11e-103
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000184
Further Details:      
 
Domain Number 2 Region: 382-557
Classification Level Classification E-value
Superfamily Fibronectin type III 1.36e-25
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 3 Region: 29-188
Classification Level Classification E-value
Superfamily Fibronectin type III 1.85e-24
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 4 Region: 208-365
Classification Level Classification E-value
Superfamily Fibronectin type III 5.46e-24
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 5 Region: 555-648
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000419
Family Fibronectin type III 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019771   Gene: ENSPTRG00000011492   Transcript: ENSPTRT00000021424
Sequence length 1112
Comment pep:known chromosome:CHIMP2.1.4:19:60104648:60134214:-1 gene:ENSPTRG00000011492 transcript:ENSPTRT00000021424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAGRGLGVWGNLVLLGLCSWTGARAPAPNPGRNLTVETQTTSSISLSWKAPDGTDSQN
SNYSVQCTGDGGRSETRTTRYTVIVYGLGPGSLYTCSVSVEKDGVNSSVGTVTGATAPNP
VRNLRVEAQTNSSITLTWEADGPDPQNSTYWVEYTGDGGTAGTRSTANTNITVDGLEPGC
LYAFSVWVGKNGINSSRETRNATIAAYPVRNLTVEAQTTSSISLSWEVPDGTDSQNSTYC
VQCTGDGGRTETRNTTDTRVTVDGLGPGSLYTCSVWVEKDGVNSSVEIVTSATAPNPVRN
LTVEAQTNSSITLTWEADGPDPQNSTYWVEYTGDGGTAGTRSTANTNITVDRLEPGCLYA
FSVWVGKNGINSSRETRNATTAPNPVRNLHMETQTNSSIALSWEVPSGPDPQDYTYWVEY
TGDGGGTETRNTTNISVTAEGLEPGTLYTFSVWAEKNGARGSRQNVSFSTVPNAVTSLSK
QDWTNSTIALRWTAPEGPGQSSYSYWVSWVREGMTDPRTQSTSGTDITLKELEAGSLYHL
TVWAERNEVRGYNSTLTAATAPNEVTDLQNETQTKNSVMLWWKAPGDPHSQLYVYWVQWA
SKGHPQRGQDPQANWVNQTSRTNETWYKVEALEPGTLYNFTVWAERNDVASSTQSLCAST
YPDAVTITSCVSTSAGYGVNLIWSCPQGGYEAFELEVGGQRGSQDRSSCGEAVSVLGLGP
ARSYPATITTIWDGMKVVSHSVVCHTESAGVIAGAFVGILLFLILVGLLIFFLKRRNNKK
QQKPELRNLVFSSPGDIPAEDFADHVRKNERDSNCGFADEYQQLSLVGHSQSQMVASASE
NNAKNRYRNVLPYDWSRVPLKPIHEEPGSDYINASFMPGLWSPQEFIATQGPLPQTVGDF
WRLVWEQQSHTLVMLTNCMEAGRVKCEHYWPLDSQPCTHGHLRVTLVGEEVMENWTVREL
QLLQVEEQKTLSVRQFHYQAWPDHGVPSSPDTLLAFWRMLRQWLDQTMEGGPPIVHCSAG
VGRTGTLIALDVLLRQLQSEGLLGPFSFVRKMRESRPLMVQTEAQYVFLHQCILRFLQQS
AQAPAKKEVPYEDVENLIYENVAAIQAHKLEV
Download sequence
Identical sequences A0A2J8IWY0
ENSPTRP00000019771 9598.ENSPTRP00000019771 ENSPTRP00000019771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]