SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021736 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021736
Domain Number 1 Region: 78-151
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.53e-21
Family Dual specificity phosphatase-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021736   Gene: ENSPTRG00000012710   Transcript: ENSPTRT00000023566
Sequence length 166
Comment pep:known chromosome:CHIMP2.1.4:2B:187638008:187654501:1 gene:ENSPTRG00000012710 transcript:ENSPTRT00000023566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDL
SSDLQVGVIKPWLLLGSQDAAHDLDTLKKNKDGVVLVHCNAGVSRAAAIVIGFLMNSEQT
SFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS
Download sequence
Identical sequences A0A2I3TGB1
ENSPTRP00000021736 NP_001135786.1.87134 NP_001135786.1.92137 XP_001160177.1.37143 gi|214832050|ref|NP_001135786.1| ENSPTRP00000021736 ENSP00000343905 ENSP00000343905 9598.ENSPTRP00000021736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]