SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022062 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022062
Domain Number 1 Region: 179-306
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.45e-40
Family PLC-like (P variant) 0.0029
Further Details:      
 
Domain Number 2 Region: 12-177
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.72e-32
Family Dual specificity phosphatase-like 0.00011
Further Details:      
 
Domain Number 3 Region: 1433-1575
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-22
Family SH2 domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022062   Gene: ENSPTRG00000012906   Transcript: ENSPTRT00000023926
Sequence length 1595
Comment pep:known chromosome:CHIMP2.1.4:2B:222859305:222955752:-1 gene:ENSPTRG00000012906 transcript:ENSPTRT00000023926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSRTMEDSCELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGNYLLFNL
SERRPDITKLHAKVLEFGWPDLHTPALEKICSICKAMDTWLNADPHNVVVLHNKGNRGRI
GVVIAAYMHYSNISASADQALDRFAMKRFYEDKIVPIGQPSQRRYVHYFSGLLSGSIKMN
NKPLFLHHVIMHGIPNFESKGGCRPFLRIYQAMQPVYTSGIYNIPGDSQTSVCITIEPGL
LLKGDILLKCYHKKFRSPARDVIFRVQFHTCAIHDLGVVFGKEDLDDAFKDDRFPEYGKV
EFVFSYGPEKIQGMEHLENGPSVSVDYNTSDPLIRWDSYDNFSGHRDDGMEEVVGHTQGP
LDGSLYAKVKKKDSLHGSTGAVNATRPTLSATPNHVEHTLSVSSDSGNSTASTKTDKTDE
PVPGASSATAALSPQEKRELDRLLSGFGLEREKQGAMYHTQHLRSRPAGGSAVPSSGRHV
VPAQVHVNGGALASERETDILDDELPNQDGHSAGSMGTLSSLDGVTNTSEGGYPEALSPL
TNGLDKSYPMEPMVNGGGYPYESASRAGPAHAGHTAPMRPSYSAQEGLAGYQREGPHPAW
PQPVTTSHYAHDPSGMFRSQSFSEAEPQLPPAPVRGGSSREAVQRGLNSWQQQQQQQPRP
PPRQQERAHLESLVASRPSPQPLAETPIPSLPEFPRAASQQEIEQSIETLNMLMLDLEPA
SAAAPLHKSQSVPGAWPGASPLSSQPLSGSSRQSHPLTQSRSGYIPSGHSLGTPEPAPRA
SLESVPPGRSYSPYDYQPCLAGPNQDFHSKSPASSSLPAFLPTTHSPPGPQQPPASLPGL
TAQPLLSPKEATSDPSRTPEEEPLNLEGLVAHRVAGVQAREKQPAEPPAPLRRRAASDGQ
YENQSPEATSPRSPGVRSPVQCVSPELALTIALNPGGRPKEPHLHSYKEAFEEMEGTSPS
SPPPSGVRSPPGLAKTPLSALGLKPHNPADILLHPTGVTRRRIQPEEDEGKVVVRLSEEP
RSYVESVARTAVVGPRAQDSEPKSFSAPATQAYGHEIPLRNGTLGGSFVSPSPLSTSSPI
LSADSTSVGSFPSGESSDHGPRTPTQPLLESGFRSGSLGQPSPSAQRNYQSSSPLPTVGS
SYSSPDYSLQHFSSSPESQARAQFSVAGVHTVPGSPQARHRTVGTNTPPSPGFGRRAINP
SMAAPSSPSLSHRQMMGPPGTGFHGSTVSSPQSSAATTPGSPSLGRHPAGAYQVSGLHNN
VATTPGSPSLGRHPGAHQGNLASGLHSNAIASPGSPSLGRHLGGSGSVVPGSPCLDRHVA
YGGYSTPEDRRPTLSRQSSASGYQAPSTPSFPVSPAYYPALSSPATSPSPDSAAFRQGSP
TPALPEKRRMSVGDRAGSLPNYATINGKVSSPVASGMSSPSGGSTISFSHTLPDFSKYSM
PDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMK
VSSPPPTIMQQNKKGDMTHELVRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQHSIIPL
ALPCKLVIPNRDPTDESKDSSGPANSTADLLKQGA
Download sequence
Identical sequences ENSPTRP00000022062 ENSPTRP00000022062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]