SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022435 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022435
Domain Number 1 Region: 14-160
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.36e-35
Family Dual specificity phosphatase-like 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022435   Gene: ENSPTRG00000013106   Transcript: ENSPTRT00000024314
Sequence length 176
Comment pep:known chromosome:CHIMP2.1.4:2B:245910539:245914533:1 gene:ENSPTRG00000013106 transcript:ENSPTRT00000024314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGEAGRRGAASPVPPPFVRVAPSLFLGSARAAGAEEQLARAGVTLCVNVSRQQPGPRA
PGVAELRVPVFDDPAEDLLAHLEPTCAAMEAAVRAGGACLVYCKNGRSRSAAVCTAYLMR
HRGLSLAKAFQMVKSARPVAEPNPGFWSQLQKYEEALQAQSCLQGEPPALGLGPEA
Download sequence
Identical sequences H2QJQ7
ENSPTRP00000022435 ENSPTRP00000022435 9598.ENSPTRP00000022435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]