SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000024545 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000024545
Domain Number 1 Region: 21-178
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.6e-69
Family SCOPe 0.0000227
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000024545   Gene: ENSPTRG00000014254   Transcript: ENSPTRT00000026629
Sequence length 188
Comment pep:known chromosome:CHIMP2.1.4:22:29338001:29343818:-1 gene:ENSPTRG00000014254 transcript:ENSPTRT00000026629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTL
YEDIQYMQVPVADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLM
KYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEK
EVRLMIPL
Download sequence
Identical sequences A0A024R1L2 K7APU8 Q8NEJ0
9598.ENSPTRP00000024545 9606.ENSP00000333917 ENSPTRP00000024545 NP_001291723.1.87134 NP_001291723.1.92137 NP_001291724.1.87134 NP_001291724.1.92137 NP_689724.3.87134 NP_689724.3.92137 XP_001144474.1.37143 XP_001144555.1.37143 XP_003317245.1.37143 XP_003317246.1.37143 XP_005261425.1.92137 XP_006724211.1.92137 XP_011528222.1.92137 XP_011528223.1.92137 XP_016794470.1.37143 XP_016794471.1.37143 XP_016884116.1.92137 XP_016884117.1.92137 ENSP00000333917 ENSP00000366291 ENSP00000385463 ENSP00000386063 ENSPTRP00000024545 gi|51093845|ref|NP_689724.3| 2esb_A ENSP00000333917 ENSP00000366291 ENSP00000385463 ENSP00000386063 ENSP00000333917 DUSP18 HR6764 NYSGXRC-8699a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]