SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027914 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000027914
Domain Number 1 Region: 2170-2468
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.1e-96
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000382
Further Details:      
 
Domain Number 2 Region: 665-773
Classification Level Classification E-value
Superfamily Second domain of FERM 7.2e-33
Family Second domain of FERM 0.0002
Further Details:      
 
Domain Number 3 Region: 1349-1457
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-28
Family PDZ domain 0.0000187
Further Details:      
 
Domain Number 4 Region: 1074-1181
Classification Level Classification E-value
Superfamily PDZ domain-like 5.13e-27
Family PDZ domain 0.0073
Further Details:      
 
Domain Number 5 Region: 775-881
Classification Level Classification E-value
Superfamily PH domain-like 2.4e-26
Family Third domain of FERM 0.0022
Further Details:      
 
Domain Number 6 Region: 1781-1870
Classification Level Classification E-value
Superfamily PDZ domain-like 7.76e-22
Family PDZ domain 0.015
Further Details:      
 
Domain Number 7 Region: 1490-1593
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-20
Family PDZ domain 0.028
Further Details:      
 
Domain Number 8 Region: 1873-1963
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-17
Family PDZ domain 0.041
Further Details:      
 
Domain Number 9 Region: 571-664
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.86e-17
Family First domain of FERM 0.014
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000027914
Domain Number - Region: 2-161
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000401
Family Protein kinases, catalytic subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027914   Gene: ENSPTRG00000016249   Transcript: ENSPTRT00000030243
Sequence length 2483
Comment pep:known chromosome:CHIMP2.1.4:4:88847689:89070845:1 gene:ENSPTRG00000016249 transcript:ENSPTRT00000030243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSLADPAALGFIISPWSLLLLP
SGSVSFTDENISNQDLRAFTAPEVLQNQSLTSLSDVEKIHIYSLGMTLYWGADYEVPQSQ
PIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKHLVKLVLGNL
SGTDQLSCNSEQKPDRSQAIRDRLRGKGLPTGRSSTSDVLDIQKPPLSHQTFLNKGLSKS
MGFLSIKDTQDEDYFKDILSDNSGHEDSENTCSPYQFKTSGPEKKPIPGIDVLSKKKIWA
SSMDLLCTADRDFSSGETATYRRCHPEAVTVRTSTTPRKKEARYSDGSIALDIFGPQKMD
PIYHTRELPTSSAISSALDRIRERQKKLQVLREAMNVEEPVRRYKTYHGDVFSTSSESPS
IISSESDFRQVRRSEASKRFESSSGLPGVDETLSQGQSQRPSRQYETPFEGNLINQEIML
KRQEEELMQLQAKMALRQSRLSLYPGDTIKASMLDITRDPLREIALETAMTQRKLRNFFG
PEFVKMTIEPFISLDLPRSILTKKGKNEDNRRKVNIMLLNGQRLELTCDTKTICKDVFDM
VVAHIGLVEHHLFALATLKDNEYFFVDPDLKLTKVAPEGWKEEPKKKTKATVNFTLFFRI
KFFMDDVSLMQHTLTCHQYYLQLRKDILEERMHCDDETSLLLASLALQAEYGDYQPEVHG
VSYFRMEHYLPARVMEKLDLSYIKEELPKLHNTYVGASEKETELEFLKVCQRLTEYGVHF
HRVHPEKKSQTGILLGVCSKGVLVFEVHNGVRTLVLRFPWRETKKISFSKKKITLQNTSD
GIKHAFQTDNSKICQYLLHLCSYQHKFQLQMRARQSNQDAQDIERASFRSLNLQAESVRG
FNMGRAISTGSLASSTLNKLAVRPLSVQAEILKRLSCSELSLYQPLQNNSKEKNDKASWE
EKPREMSKSYHDLSQASLYPHRKNVIVNMEPPPQTVAELVGKPSHQMSRSDAESLAGVTK
LNNSKSVASLNRSPERRKHESDSSSIEDPGQAYVLGMTMHSSGNSSSQVPLKENDVLHKR
WSIVSSPEREITLVNLKKDAKYGLGFQIIGGEKMGRLDLGIFISSVAPGGPADLDGCLKP
GDRLISVNSVSLEGVSHHAAIEILQNAPEDVTLVISQPKEKISKVASTPVHLTNEMKNYM
KKSSYMXDSAIDSSSXDHWSRGTLRHISENSFGLSGGLREGKLSFSDRTESASLSQSQVN
GFFASHLGDQTWQESQHGSPSPSVISKATEKETFTDSNQSKTKKPGISDVTDYSDRGDSD
MDEATYSSSQDHQTPKQESSSSVNTSNKMNFKTFSSSPPKPGDIFEVELAKNDNSLGISV
TGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTG
QVVHLLLEKGQSPTSKEHVPVTPQCTLSDQNAQGQGPEKVKKTTQVKDYSFVTEENTFEV
KLFKNSSGLGFSFSREDNLIPEQINASIVRVKKLFPGQPAAESGKIDVGDVILKVNGASL
KGLSQQEVISALRGTAPEVFLLLCRPPPGVLPEIDTALLTPLQSPAQVLPNSSKDSSQPS
CVEQSTSSDENEMSDKSKKQCKSPSRRDSYSDSSGSGEDDLVTAPANISNSTWSSALHQT
LSNMVSQAQSHHEAPKSQEDTICTMFYYPQKIPNKPEFEDSNPSPLPPDMAPGQSYQPQS
ESASSSSMDKYHIHHISEPTRQENWTPLKNDLENHLEDFELEVELLITLIKSEKGSLGFT
VTKGNQRIGCYVHDVIQDPAKSDGRLKPGDRLIKVNDTDVTNMTHTDAVNLLRAASKTVR
LVIGRVLELPRIPMLPHLLPDITLTCNKEELGFSLCGGHDSLYQVVYISDINPRSVAAIE
GNLQLLDVIHYVNGVSTQGMTLEEVNRALDMSLPSLVLKATRNDLPVVPSSKRSAVSAPK
STKGNGSYSVGSCSQPALTPNDSFSTVAGEEINEISYPKGKCSTYQIKGSPNLTLPKESY
IQEDDIYDDSQEAEVIQSLLDVVDEEAQNLLNENNAAGNSCGPGTLKMNGKLSEERTEDT
DCDGSPLPEYFTEATKMNGCEEYCEEKVRSESLIQKPQEKKTDDDEITWGNDELPIERTN
HEDSDKDHSFLTNDELAVLPVVKVLPSGKYTGANLKSVIRVLRGLLDQGIPSKELENLQE
LKPLDQCLIGQTKENRRKNRYKNILPYDATRVPLGDEGGYINASFIKIPVGKEEFVYIAC
QGPLPTTVGDFWQMIWEQKSTVIAMMTQEVEGEKIKCQRYWPNILSKTTMVSNRLRLALV
RMQQLKGFVVRAMTLEDIQTREVRHISHLNFTAWPDHDTPSQPDDLLTFISYMRHIHRSG
PIITHCSAGIGRSGTLICIDVVLGLISQDLDFDISDLVRCMRLQRHGMVQTEDQYIFCYQ
VILYVLTRLQAEEEQKQQPQLLK
Download sequence
Identical sequences ENSPTRP00000027914 ENSPTRP00000027914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]