SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029948 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029948
Domain Number 1 Region: 164-312
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-45
Family Dual specificity phosphatase-like 0.00000243
Further Details:      
 
Domain Number 2 Region: 3-143
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 2.1e-23
Family Cell cycle control phosphatase, catalytic domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029948   Gene: ENSPTRG00000017534   Transcript: ENSPTRT00000032412
Sequence length 367
Comment pep:known chromosome:CHIMP2.1.4:5:173797766:173800876:-1 gene:ENSPTRG00000017534 transcript:ENSPTRT00000032412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMEVGTLDAGGLRALLGERAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAM
GLEHIVPNAELRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREARAAQVFF
LKGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILPF
LYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEA
IDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFS
FMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSP
ITTSPSC
Download sequence
Identical sequences G3QW32 H2PHD7 H2QS06 P28562
ENSPTRP00000029948 ENSP00000239223 ENSP00000239223 ENSPPYP00000017960 ENSPPYP00000017960 gi|4758204|ref|NP_004408.1| 9598.ENSPTRP00000029948 9600.ENSPPYP00000017960 9606.ENSP00000239223 HR2964 NYSGXRC-8651a ENSPTRP00000029948 NP_004408.1.87134 NP_004408.1.92137 XP_002816250.1.23681 XP_003814043.1.60992 XP_004043046.1.27298 XP_527120.2.37143 ENSP00000239223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]