SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031727 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031727
Domain Number 1 Region: 871-1186
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.76e-107
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000012
Further Details:      
 
Domain Number 2 Region: 1144-1444
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.44e-82
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000915
Further Details:      
 
Domain Number 3 Region: 34-192
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.11e-39
Family MAM domain 0.0000044
Further Details:      
 
Domain Number 4 Region: 393-590
Classification Level Classification E-value
Superfamily Fibronectin type III 4.31e-25
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 5 Region: 290-420
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000182
Family Fibronectin type III 0.007
Further Details:      
 
Domain Number 6 Region: 196-298
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000565
Family I set domains 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000031727
Domain Number - Region: 607-719
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0834
Family Fibronectin type III 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031727   Gene: ENSPTRG00000018587   Transcript: ENSPTRT00000034323
Sequence length 1446
Comment pep:known chromosome:CHIMP2.1.4:6:129249623:129815154:-1 gene:ENSPTRG00000018587 transcript:ENSPTRT00000034323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSAGGCTFDDGPGACDYHQDLYDDFEWVHV
SAQEPHYLPPEMPQGSYMIVDSSDHDPGEKARLQLPTMKENDTHCIDFSYLLYSQKGLNP
GTLNILVRVNKGPLANPIWNVTGFTGRDWLRAELAVSTFWPNEYQVIFEAEVSGGRSGYI
AIDDIQVLSYPCDKSPHFLRLGDVEVNAGQNATFQCIATGRDAVHNKLWLQRRNGEDIPV
AQTKNINHRRFAASFRLQEVTKTDQDLYRCVTQSERGSGVSNFAQLIVREPPRPIAPPQL
LGVGPTYLLIQLNANSIIGDGPIILKEVEYRMTSGSWTETHAVNAPTYKLWHLDPDTEYE
IRVLLTRPGEGGTGLPGPPLITRTKCAEPMRTPKTLKIAEIQARRIAVDWESLGYNITRC
HTFNVTICYHYFRGHNESKADCLDMDPKAPQHVVNHLPPYTNVSLKMILTNPEGRKESEE
TIIQTDEDVPGPVPVKSLQGTSFENKIFLNWKEPLDPNGIITQYEISYSSIRSFDPAVPV
AGPPQTVSNLWNSTHHVFMHLHPGTTYQFFIRASTVKGFGPATAINVTTNISAPTLPDYE
GVDASLNETATTITVLLRPAQAKGAPISAYQIVVEELHPHRTKREAGAMECYQVPVTYQN
AMSGGAPYYFAAELPPGNLPEPAPFTVGDNRTYQGFWNPPLAPRKGYNIYFQAMSSVEKE
TKTQCVRIATKAAATEEPEVIPDPAKQTDRVVKIAGISAGILVFILLLLVVILIVKKSKL
AKKRKDAMGNTRQEMTHMVNAMDRSYADQSTLHAEDPLSITFMDQHNFSPRYENHSATAE
SSRLLDVPRYLCEGTESPYQTGQLHPAIRVADLLQHINLMKTSDSYGFKEEYESFFEGQS
ASWDVAKKDQNRAKNRYGNIIAYDHSRVILQPVEDDPSSDYINANYIDIWLYRDGYQRPS
HYIATQGPVHETVYDFWRMIWQEQSACIVMVTNLVEVGRVKCYKYWPDDTEVYGDFKVTC
VEMEPLAEYVVRTFTLERRGYNEIREVKQFHFTGWPDHGVPYHATGLLSFIRRVKLSNPP
SAGPIVVHCSAGAGRTGCYIVIDIMLDMAEREGVVDIYNCVKALRSRRINMVQTEEQYIF
IHDAILEACLCGETAIPVCEFKAAYFDMIRIDSQTNSSHLKDEFQTLNSVTPRLQAEDCS
IACLPRNHDKNRFMDMLPPDRCLPFLITIDGESSNYINAALMDSYRQPAAFIVTQYPLPN
TVKDFWRLVYDYGCTSIVMLNEVDLSQGCPQYWPEEGMLRYGPIQVECMSCSMDCDVINR
IFRICNLTRPQEGYLMVQQFQYLGWASHREVPGSKRSFLKLILQVEKWQEECEEGEGRTI
IHCLNGGGRSGMFCAIGIVVEMVKRQNVVDVFHAVKTLRNSKPNMVEAPEQYRFCYDVAL
EYLESS
Download sequence
Identical sequences A0A2J8PTG1
NP_001129120.1.87134 NP_001129120.1.92137 XP_001167592.2.37143 XP_003827686.1.60992 ENSPTRP00000031727 ENSPTRP00000031727 9606.ENSP00000357209 ENSP00000357196 ENSP00000483766 ENSP00000357196 gi|208431815|ref|NP_001129120.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]