SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031825 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031825
Domain Number 1 Region: 143-261
Classification Level Classification E-value
Superfamily Fibronectin type III 3.44e-28
Family Fibronectin type III 0.0052
Further Details:      
 
Domain Number 2 Region: 30-65,98-168
Classification Level Classification E-value
Superfamily Fibronectin type III 3.19e-26
Family Fibronectin type III 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031825   Gene: ENSPTRG00000018641   Transcript: ENSPTRT00000034433
Sequence length 263
Comment pep:known chromosome:CHIMP2.1.4:6:138491691:138521851:-1 gene:ENSPTRG00000018641 transcript:ENSPTRT00000034433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVY
FVQYKIMFSCSMKSSHQKPSGCWQHTSCNFPGCRTLAKYGQRQWKNKEDCWGTQELFCDL
TSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHA
PNLPYRYQKEKNVSIEDYYELLYQVFIINNSLEKEQKVYEGAHRVVEIEALTPHSSYCVV
AEIYQPMLDRRSQRSEERCVEIP
Download sequence
Identical sequences A0A2I3TXE3
XP_001171428.1.37143 9598.ENSPTRP00000031825 ENSPTRP00000031825 ENSPTRP00000031825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]