SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031881 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031881
Domain Number 1 Region: 149-305
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.77e-26
Family Dual specificity phosphatase-like 0.026
Further Details:      
 
Domain Number 2 Region: 16-122
Classification Level Classification E-value
Superfamily Starch-binding domain-like 6.87e-16
Family Starch-binding domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031881   Gene: ENSPTRG00000018681   Transcript: ENSPTRT00000034491
Sequence length 331
Comment pep:known chromosome:CHIMP2.1.4:6:147129274:147234579:-1 gene:ENSPTRG00000018681 transcript:ENSPTRT00000034491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFRFGVVVPPAVAGARPELLVVGSRPELGRWEPRGAVRLRPAGTAAGAGALALQEPGLW
LGEVELAAEEAAQDGAEPGRVDTFWYKFLKREPGGELSWEGNGPHHDRCCTYNENNLVDG
VYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKL
KHELGITAVMNFQTEWDIVQNSSGCNRYPEPMTPDTMIKLYREEGLAYIWMPTPDMSTEG
RVQMLPQAVCLLHALLEKGHIVYVHCNAGVGRSTAAVCGWLQYVMGWNLRKVQYFLMAKR
PAVYIDEEALARAQEDFFQKFGKVRSSVCSL
Download sequence
Identical sequences H2QTV6
XP_001161292.2.37143 ENSPTRP00000031881 ENSPTRP00000031881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]