SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000033038 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000033038
Domain Number 1 Region: 146-302
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.8e-29
Family Dual specificity phosphatase-like 0.001
Further Details:      
 
Domain Number 2 Region: 3-152
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 5.96e-16
Family Cell cycle control phosphatase, catalytic domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000033038   Gene: ENSPTRG00000019315   Transcript: ENSPTRT00000035741
Sequence length 313
Comment pep:known chromosome:CHIMP2.1.4:7:76062001:76114083:-1 gene:ENSPTRG00000019315 transcript:ENSPTRT00000035741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALGVKKKNNEY
LLPESVDLECVKYCVVYDNNSSTLEILLNDDDDDSDSDGDGKDLVPQAAIEYGRILTRRT
HHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIVPGKVFIGNFSQACDPK
IQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIKDSPEAQILPFLRHMCHFIEIHLHLGS
VILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNMCPNRGLVSQLLEWEKTI
LGDSITNIMDPLY
Download sequence
Identical sequences H2QUS8
XP_003951102.1.37143 XP_009451639.1.37143 ENSPTRP00000033038 ENSPTRP00000033038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]