SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000034453 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000034453
Domain Number 1 Region: 185-335
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-45
Family Dual specificity phosphatase-like 0.00000344
Further Details:      
 
Domain Number 2 Region: 3-160
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.34e-24
Family Cell cycle control phosphatase, catalytic domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000034453   Gene: ENSPTRG00000020129   Transcript: ENSPTRT00000037281
Sequence length 394
Comment pep:known chromosome:CHIMP2.1.4:8:25699073:25708372:-1 gene:ENSPTRG00000020129 transcript:ENSPTRT00000037281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTMEELREMDCSVLKRLMNRDENGGGAGGSGSHGTLGLPSGGKCLLLDCRPFLAHSAGY
IRGSVNVRCNTIVRRRAKGSVSLEQILPAEEEVRARLRSGLYSAVIVYDERSPRAESLRE
DSTVSLVVQALRRNAERTDICLLKGGYERFSSEYPEFCSKTKALAAIPPPVPPSATEPLD
LGCSSCGTPLHDQGGPVEILPFLYLGSAYHAARRDMLDALGITALLNVSSDCPNHFEGHY
QYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAGISRSATICLAYLMMKKR
VRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCAAEAASPSGPLRERGKTPATP
TSQFVFSFPVSVGVHSAPSSLPYLHSPITTSPSC
Download sequence
Identical sequences G1S474 G3QSY8 H2QVZ4
ENSPTRP00000034453 XP_003272976.1.23891 XP_003830821.1.60992 XP_004046895.1.27298 XP_520046.2.37143 ENSPTRP00000034454 ENSNLEP00000020312 ENSNLEP00000020312 9598.ENSPTRP00000034454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]