SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000035275 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000035275
Domain Number 1 Region: 8-165
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.18e-40
Family Dual specificity phosphatase-like 0.000000075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000035275   Gene: ENSPTRG00000020631   Transcript: ENSPTRT00000038154
Sequence length 173
Comment pep:novel chromosome:CHIMP2.1.4:8:140201465:140210769:1 gene:ENSPTRG00000020631 transcript:ENSPTRT00000038154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEK
DGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALI
ESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKEPHTHKTRCCVM
Download sequence
Identical sequences A0A2I3REL6
XP_003819536.1.60992 XP_008971103.1.60992 XP_008971104.1.60992 XP_009454312.1.37143 XP_009454313.1.37143 XP_014201571.1.60992 XP_016815436.1.37143 XP_016815437.1.37143 XP_016815438.1.37143 XP_016815439.1.37143 XP_016815440.1.37143 XP_016815442.1.37143 ENSPTRP00000035275 ENSPTRP00000035275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]