SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036117 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036117
Domain Number 1 Region: 131-296
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.11e-38
Family Dual specificity phosphatase-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036117   Gene: ENSPTRG00000021130   Transcript: ENSPTRT00000039084
Sequence length 806
Comment pep:known chromosome:CHIMP2.1.4:9:92851071:92931152:1 gene:ENSPTRG00000021130 transcript:ENSPTRT00000039084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVQDATRRPSAVHFLSSFLQGRRHSTSDPVLRLQQARRGSGLGSGSATKLLSSSSLQVM
VAVSSVSHAEGNPTFPERKRNLERPTPKYTKVGERLRHVIPGHMACSMACGGRACKYENP
ARWSEPEQAIKGVYSSWVTDNILAMARPSSELLEKYHIIDQFLSHGIKTIINLQRPGEHA
SCGNPLEQESGFTYLPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAI
HCHAGLGRTGVLIACYLVFATRMTADQAIIFVRAKRPNSIQTRGQLLCVREFTQFLTPLR
NIFSCCDPKAHAVTLPQYLIRQRHLLHGYEARLLKHVPKIIHLVCKLLLDLAENRPVMMK
DVSEGPGLSAEIEKTMSEMVTMQLDKELLRHDSDVSNPPNPTAMAADFDNRGMIFSNEQQ
FDPLWKRRNVECLQPLTHLKRRLSYSDSDLKRAENLLEQGETPQTVPAQILVGHKPRQQK
LISHCYIPQSPEPDLHKEALVRSTLSFWSQSKFGGLEGLKDNGSPIFHGRIIPKEAQQSG
AFSADVSGSHSPGEPVSPSFANVHRDPNPAHQQVSHCQCKTHGVGSPGSVRQNSRTPRSP
LDCGSSPKAQFLVAHETQDSKDLSEAASHSALQSELSAEARRILAAKALANLNESVEKEE
LKRKVEMWQKELNSRDGAWERICGERDPFILCSLMWSWVEQLKEPVITKEDVDMLVDRRA
DATEALFLLEKGQHQTILCVLHCVVNLQTIPVDVEEAFLAHAIKAFTKVNFDSENGPTVY
NTLKKIFKHTLEEKRKMTKDGPKPGL
Download sequence
Identical sequences A0A2J8J3D7
9598.ENSPTRP00000036116 XP_520702.2.37143 ENSPTRP00000036117 ENSPTRP00000036116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]