SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000037747 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000037747
Domain Number 1 Region: 122-504
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.34e-151
Family Myotubularin-like phosphatases 0.0000000173
Further Details:      
 
Domain Number 2 Region: 7-114
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000148
Family GRAM domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000037747   Gene: ENSPTRG00000021967   Transcript: ENSPTRT00000040855
Sequence length 710
Comment pep:known chromosome:CHIMP2.1.4:X:63788888:63912024:-1 gene:ENSPTRG00000021967 transcript:ENSPTRT00000040855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHITVPKVENVKLVDRYVSKKPANGILYLTATHLIYVEASGAARKETWIALHHIATVEK
LPITSLGCPLTLRCKNFRVAHFVLDSDLVCHEVYISLLKLSQPALPEDLYAFSYNPKSSK
EMRESGWKLIDPISDFGRMGIPNRNWTITDANRNYEICSTYPPEIVVPKSVTLGTVVGSS
KFRSKERVPVLSYLYKENNAAICRCSQPLSGFYTRCVDDELLLEAISQTNPGSQFMYVVD
TRPKLNAMANRAAGKGYENEDNYANIRFRFMGIENIHVMRSSLQKLLEVCELKTPTMSEF
LSGLESSGWLRHIKAIMDAGIFITKAVKVEKASVLVHCSDGWDRTAQVCSVASILLDPFY
RTFKGLMILIEKEWISMGHKFSQRCGHLDGDSKEVSPIFTQFLDCIWQLMEQFPCAFEFN
ENFLLEIHDHVFSCQFGNFLGNCQKDREDLRVYEKTHSVWPFLVQRKPDFRNPLYKGFTM
YGVLNPSTVPYNIQFWCGMYNRFDKGLQPKQSMLESLLEIKKQRAMLETDVHELEKKLKV
RDEPPEEICTCSQLGNILSQHLGSPLTNPLGFMGINGDLNTLMENGTLSREGGLRAQMDQ
VKSQCADLHHNCCEIVGSLRAINISGDVGISGGTGISEAMGISGDMSTFEATGFSEDLGI
CGAMDISEATGISGNLGISEARGFSGDMGILGDTGISKASTKEADYSKHQ
Download sequence
Identical sequences H2QYP9
XP_521093.2.37143 ENSPTRP00000037747 ENSPTRP00000037747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]