SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000038536 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000038536
Domain Number 1 Region: 220-605
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.29e-156
Family Myotubularin-like phosphatases 0.0000000000106
Further Details:      
 
Domain Number 2 Region: 97-217
Classification Level Classification E-value
Superfamily PH domain-like 6.39e-38
Family GRAM domain 0.0000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000038536   Gene: ENSPTRG00000022368   Transcript: ENSPTRT00000041727
Sequence length 610
Comment pep:known chromosome:CHIMP2.1.4:X:151509156:151585775:1 gene:ENSPTRG00000022368 transcript:ENSPTRT00000041727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRPAAAAAGCEGGGGPNPGPAGGRRPPRAAGGATAGSRQPSVETLDSPTGSHVEWCKQL
IAATISSQISGSVTSENVSRDYKALRDGNKLAQMEEAPLFPGESIKAIVKDVMYICPFMG
AVSGTLTVTDFKLYFKNVERDPHFILDVPLGVISRVEKIGAQSHGDNSCGIEIVCKDMRN
LRLAYKQEEQSKLGIFENLNKHAFPLSNGQXXXXFRYKEKFPINGWKVYDPVFEYKRQGL
PNESWKISKINSNYEFCDTYPAIIVVPTSVKDDDLSKVAAFRAKGRVPVLSWIHPESQAT
ITRCSQPLVGPSDKRCKEDEKYLQTIMDANAQSHKLIIFDARQNSVADTNKTKGGGYESE
SAYPNAELVFLEIHNIHVMRESLRKLKEIVYPSIDEARWLSNVDGTHWLEYIRMLLAGAV
RIADKIESGKTSVVVHCSDGWDRTAQLTSLAMLMLDSYYRTIKGFETLVEKEWISFGHRF
ALRVGHGNDNHADADRSPIFLQFVDCVWQMTRQFPSAFEFNELFLITILDHLYSCLFGTF
LCNCEQQRFKEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNYY
VRWNPRMRPQ
Download sequence
Identical sequences ENSPTRP00000038536 ENSPTRP00000038536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]