SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000041684 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000041684
Domain Number 1 Region: 1299-1439
Classification Level Classification E-value
Superfamily PH domain-like 4.1e-54
Family Phosphotyrosine-binding domain (PTB) 0.00000175
Further Details:      
 
Domain Number 2 Region: 173-301
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.31e-38
Family PLC-like (P variant) 0.0019
Further Details:      
 
Domain Number 3 Region: 7-170
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.31e-30
Family Dual specificity phosphatase-like 0.00021
Further Details:      
 
Domain Number 4 Region: 1165-1286
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-23
Family SH2 domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000041684   Gene: ENSPTRG00000019170   Transcript: ENSPTRT00000048607
Sequence length 1445
Comment pep:known chromosome:CHIMP2.1.4:7:45875823:46182773:-1 gene:ENSPTRG00000019170 transcript:ENSPTRT00000048607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGHGLDLTYITERIIAVSFPAGCSEESYLHNLQEVTRMLKSKHGDNYLVLNLSEKRYD
LTKLNPKIMDVGWPELHAPPLDKMCTICKAQESWLNSNPQHVVVIHCRGGKGRIGVVISS
YMHFTNVSASADQALDRFAMKKFYDDKVSALMQPSQKRYVQFLSGLLSGSVKMNASPLFL
HFVILHGTPNFDTGGVCRPFLKLYQAMQPVYTSGIYNVGPENPSRICIAIEPAQLLKGDV
MVKCYHKKYRSATRDVIFRLQFHTGAVQGYGLVFGKEDLDNASKDDRFPDYGKVELVFSA
TPEKIQGSEHLYNDHGVIVDYNTTDPLIRWDSYENLSADGEVLHTQGPVDGSLYAKVRKK
SSSDPGIPGGPQAIPATNSPDHSDHTLSVSSDSGHSTASARTDKTEERLAPGTRRGLSAQ
EKAELDQLLSGFGLEDPGSSLKEMTDARSKYSGTRHVVPAQVHVNGDAALKDRETDILDD
EMPHHDLHSVDSLGTLSSSEGPQSAHLGPFTCHKSSQNSLLSDGFGSNVGEDPQGTLVPD
LGLGMDGPYERERTFGSREPKQPQPLLRKPSVSAQMQAYGQSSYSTQTWVRQQQMVVAHQ
YTFAPDGEARLVSRCPADNPGLVQAQPRVPLTPTRGTSSRVAVQRGVGSGPHPPDTQQPS
PSKAFKPRFPGDQVVNGAGPELSTGPSPGSPTLDIDQSIEQLNRLILELDPTFEPIPTHM
NALGSQANGSVSPDSVGGGLRASSRLPDTGEGPSRATGRQGSSAEQPLGGRLRKLSLGQY
DNDAGGQLPFSKCAWGKAGVDYAPNLLPFPSPADVKETMTPGYPQDLDIIDGRILSSKES
MCSTPAFPVSPETPYVKTALRHPPFSPPEPPLSSPASQHKGGREPRSCPETLTHAVGMSE
SPIGPKSTMLRADASSTPSFQQAFASSCTISSNGPGQRRESSSSAERQWVESSPKPTVSL
LGSGRPTGSPLSAEFSGTRKDSPVLSCFPPSELQAPFHSHELSLAEPPDSLAPPSSQAFL
GFGTAPVGSGLPPEEDLGALLANSHGASPTPSIPLTATGAADNGFLSHNFLTVAPGHSSH
HSPGLQGQGVTLPGQPPLPEKKRASEGDRSLGSVSPSSSGFSSPHSGSTISIPFPNVLPD
FSKASEAASPLPDSPGDKLVIVKFVQDTSKFWYKADISREQAIAMLKDKEPGSFIVRDSH
SFRGAYGLAMKVATPPPSVLQLNKKAGDLANELVRHFLIECTPKGVRLKGCSNEPYFGSL
TALVCQHSITPLALPCKLLIPERDPLEEIAESSPQTAANSAAELLKQGAACNVWYLNSVE
MESLTGHQAIQKALSITLVQEPPPVSTVVHFKVSAQGITLTDNQRKLFFRRHYPVNSVIF
CALDPQDRKWIKDGPSSKVFGFVARKQGSATDNVCHLFAEHDPEQPASAIVNFVSKVMIG
SPKKV
Download sequence
Identical sequences H2R126
9598.ENSPTRP00000041684 ENSPTRP00000041684 ENSPTRP00000041684 XP_016812918.1.37143 XP_016812920.1.37143 XP_519088.3.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]