SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000042048 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000042048
Domain Number 1 Region: 53-149,183-423
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.77e-54
Family Myotubularin-like phosphatases 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000042048   Gene: ENSPTRG00000023231   Transcript: ENSPTRT00000042203
Sequence length 589
Comment pep:novel chromosome:CHIMP2.1.4:3:9853972:9907944:1 gene:ENSPTRG00000023231 transcript:ENSPTRT00000042203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGARAAAAAASAGSSASSGNQPPQEPGLGELLEEFSRTQYRAKDGSGTGGSKVERIEKR
CLELFGRDYCFSVIPNTNGDICGHYPRHIVFLEYESSEKEKDTFESTVQVSKLQDLIHRS
KMARCRGRFVCPVILFKGKHICRSATLAGWGELYGRSGYNYFFSGGADDAWADVEDVTEE
DCALRSGDTHLFDKVRGYDIKLLRYLSVKYICDLMVENKKVKFGMNVTSSEKVDKAQRYA
DFTLLSIPYPGCEFFKEYKDRDYMAEGLIFNWKQDYVDAPLSIPDFLTHSLNIDWSQYQC
WDLVQQTQNYLKLLLSLVNSDDDSGLLVHCISGWDRTPLFISLLRLSLWADGLIHTSLKP
TEILYLTVAYDWFLFGHMLVDRLSKGEEIFFFCFNFLKHITSEEFSALKTQRGAHQARKS
HSSSPQSVLWNRPQPSEDRLPSHQGLAEARSSSSSSSNHSDNFFRMGSSPLEVPKPRSVD
HPLPRSSLSTDYGSWQMVTGCGSIQERAVLHTDSSLPFSFPDELPNSCLLAALSDRETRL
QEVRSAFLAAYSSTVGLRAVAPSPSGAIGGLLEQFARGVGLRGISSNAL
Download sequence
Identical sequences ENSPTRP00000042048 ENSPTRP00000042048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]