SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000042488 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000042488
Domain Number 1 Region: 894-1202
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.31e-107
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000997
Further Details:      
 
Domain Number 2 Region: 1165-1462
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.01e-79
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000182
Further Details:      
 
Domain Number 3 Region: 30-189
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-36
Family MAM domain 0.00000063
Further Details:      
 
Domain Number 4 Region: 390-584
Classification Level Classification E-value
Superfamily Fibronectin type III 1.44e-27
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 5 Region: 287-424
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000465
Family Fibronectin type III 0.0062
Further Details:      
 
Domain Number 6 Region: 192-295
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000272
Family I set domains 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000042488   Gene: ENSPTRG00000013505   Transcript: ENSPTRT00000046005
Sequence length 1463
Comment pep:known chromosome:CHIMP2.1.4:20:39019134:40149568:-1 gene:ENSPTRG00000013505 transcript:ENSPTRT00000046005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLSALALSLLVRLQLPPLPGARAQSAAGGCSFDEHYSNCGYSVALGTNGFAWEQINTW
EKPMLDQAVPTGSFMMVNSSGRASGQKAHLLLPTLKENDTHCIDFHYYFSSRDRSSPGAL
NVYVKVNGGPQGNPVWNVSGVVTEGWVKAELAISTFWPHFYQVIFESVSLKGHPGYIAVD
EVRVLAHPCRKAPHFLRLQNVEVNVGQNATFQCIAGGKWSQHDKLWLQQWNGRDTALMVT
RVVNHRRFSATVNVADTAQRSVSKYRCVIRSDGGSGVSNYAELIVKEPPTPIAPPELLAV
GATYLWIKPNANSIIGDGPIILKEVEYRTTTGTWAETHIVDSPNYKLWHLDPDVEYEIRV
LLTRPGEGGTGPPGPPLTTRTKCADPVHGPQNVEIVDIRARQLTLQWEPFGYAVTRCHSY
NLTVQYQYVFNQQQYEAEEVIQTSSHYTLRGLRPFMTIRLRLLLSNPEGRMESEELVVQT
EEDVPGAVPLESIQGGPFEEKIYIQWKPPNETNGVITLYEINYKAVGSLDPSADLSSQRG
KVFKLRNETHHLFVGLYPGTTYSFTIKASTAKGFGPPVTTRIATKISAPSMPEYDTDTPL
NETDTTITVMLKPAQSRGAPVSVYQLVVKEERLQKSRRAADIIECFSVPVSYRNASSLDS
LHYFAAELKPANLPVTQPFTVGDNKTYNGYWNPPLSPLKSYSIYFQALSKANGETKINCV
RLATKAPMGSAQVTPGTPLCLLTTGASTQNSNTVEPEKQVDNTVKMAGVIAGLLMFIIIL
LGVMLTIKRRRNAYSYSYYLSQRKLAKKQKETQSGAQREMGPVASADKPTTKLSASRNDE
GFSSSSQDVNGFTDGSRGELSQPTLTIQTHPYRTCDPVEMSYPRDQFQPAIRVADLLQHI
TQMKRGQGYGFKEEYEALPEGQTASWDTAKEDENRNKNRYGNIISYDHSRVRLLVLDGDP
HSDYINANYIDGYHRPRHYIATQGPMQETVKDFWRMIWQENSASIVMVTNLVEVGRVKCV
RYWPDDTEVYGDIKVTLIETEPLAEYVIRTFTVQKKGYHEIRELRLFHFTSWPDHGVPCY
ATGLLGFVRQVKFLNPPEAGPIVVHCSAGAGRTGCFIAIDTMLDMAENEGVVDIFNCVRE
LRAQRVNLVQTEEQYVFVHDAILEACLCGNTAIPVCEFRSLYYNISRLDPQTNSSQIKDE
FQTLNIVTPRVRPEDCSIGLLPRNHDKNRSMDVLPLDRCLPFLISVDGESSNYINAALMD
SHKQPAAFVVTQHPLPNTVADFWRLVFDYNCSSVVMLNEMDTAQFCMQYWPEKTSGCYGP
IQVEFVSADIDEDIIHRIFRICNMARPQDGYRIVQHLQYIGWPAYRDTPPSKRSLLKVVR
RLEKWQEQYDGREGRTVVHCLNGGGRSGTFCAICSVCEMIQQQNIIDVFHIVKTLRNNKS
NMVETLEQYKFVYEVALEYLSSF
Download sequence
Identical sequences ENSPTRP00000042488 ENSPTRP00000042488 9598.ENSPTRP00000042488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]