SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000043905 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000043905
Domain Number 1 Region: 198-539,625-646
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.62e-77
Family Myotubularin-like phosphatases 0.0000122
Further Details:      
 
Domain Number 2 Region: 43-174
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000148
Family GRAM domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000043905   Gene: ENSPTRG00000001244   Transcript: ENSPTRT00000050013
Sequence length 714
Comment pep:known chromosome:CHIMP2.1.4:1:128078901:128088109:-1 gene:ENSPTRG00000001244 transcript:ENSPTRT00000050013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWWGGRGQSFNIAPQKEEPEMGSVQENRMPEPRSRQPSSCLASRCLPGEQILAWAPGVRK
GLEPELSGTLICTNFRVTFQPCGWQWNQDTPLNSEYDFALVNIGRLEAVSGLSRVQLLRP
GSLHKFIPEEILIHGRDFRLLRVGFEAGGLEPQAFQVTMAIVQARAQSNQAQQYSGITLS
KAGQGSGSRKPPIPLMETAEDWETERKKQAARGWRVSTVNERFDVATSLPRYFWVPNRIL
DSEVRRAFGHFHQGRGPRLSWHHPGGSDLLRCGGFYTASDPNKEDIRAVELMLQAGHSDV
VLVDTMDELPSLADVQLAHLRLRALCLPDSSVAEDKWLSALEGTRWLDYVRACLRKASDI
SVLVTSRVRSVILQERGDRDLNGLLSSLVQLLSAPEARTLFGFQSLVQREWVAAGHPFLT
RLGGTGASEEAPVFLLFLDCVWQLLQQFPADFEFSEFFLLALHDSVRVPDTLTFLRNTPW
ERGKQSGQLNSYTQVYTPGYSQPPAGNSFNLQLSVWDWDLRYSNAQILQFQNPGYDPEHC
PDSWLPRPQPSFMVPGPPSSVWLFSRGALTPLNQLCPWRQSPCQQSPSLLAVSSRWLPRP
AISSESLADQEWGLPSHWGACPLPPGLLLPGYLGPQIRLWRRCYLRGRPEVQMGLSAPTI
SGLQDELSHLQELLRKWTPRISPEDHSKKRDPHTILNPTEIAGILKGRAEGDLG
Download sequence
Identical sequences A0A2I3TIP6
ENSPTRP00000043905 XP_513769.3.37143 ENSPTRP00000043905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]