SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000044530 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000044530
Domain Number 1 Region: 1117-1253,1313-1599
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.17e-109
Family Myotubularin-like phosphatases 0.00000402
Further Details:      
 
Domain Number 2 Region: 1668-1864
Classification Level Classification E-value
Superfamily PH domain-like 8.13e-28
Family Pleckstrin-homology domain (PH domain) 0.00000211
Further Details:      
 
Domain Number 3 Region: 886-1027
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000584
Family GRAM domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000044530   Gene: ENSPTRG00000014541   Transcript: ENSPTRT00000043297
Sequence length 1867
Comment pep:novel chromosome:CHIMP2.1.4:22:49378444:49410094:-1 gene:ENSPTRG00000014541 transcript:ENSPTRT00000043297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLADYFVLVAFGPHPRGSGEGQGQILQRFPEKDWEDNPFPQGIELFCQPSGWQLCPER
NPPTFFVAVLTDINSERHYCACLTFWEPAEPSQETTRVEDATEREEEGDEGGQTHLSPTA
PAPSAQLFAPKTLVLVSRLDHTEVFRNSLGLIYAIHVEGLNVCLENVIGNLLTCTVPLAG
GSQRTISLGAGDRQVIQTPLADSLPVSRCSVALLFRQLGITNVLSLFCAALTEHKVLFLS
RSYQRLADACRGLLALLFPLRYSFTYVPILPAQLLEVLSTPTPFIIGVNAAFQAETQELL
DVIVADLDGGTVTIPECVHIPPLPEPLQSQTHSVLSMVLDPELELADLAFPPPTTSTSSL
KMQDKELRAVFLRLFAQLLQGYRWCLHVVRIHPEPVIRFHKAAFLGQRGLVEDDFLMKVL
EGMAFAGFVSERGVPYRPTDLFDELVAHEVARMRADENHPQRVLRHIQELAEQLYKNENP
YPAVAMHKVQRPGESSHLRRVPRPFPRLDEGTVQWIVDQAAAKMQGAPPAVKAERRSTVP
SGPPMTAILERCSGLHVNSARRLEVVRNCISYVFEGKMLEAKKLLPAVLRALKGRAARRC
LAQELHLHVQQNRAVLDHQQFDFVVRMMNCCLQDCTSLDEHGIAAALLPLVTAFCRKLSP
GVTQFAYSCVQEHVVWSTPQFWEAMFYGDVQTHIRALYLEPTEDLAPAQEVGEAPSQEDE
RSALDVASEQRRLWPTLSREKQQELVQKEESTVFSQAIHYANRMSYLLLPLDSSKSRLLR
ERAGLGDLESASNSLVTNSMAGSVAESYDTESGFEDAETCDVAGAVVRFINRFVDKVCTE
SGVTSDHLKGLHVMVPDIVQMHIETLEAVQRESRRLPPIQKPKLLRPRLLPGEECVLDGL
RVYLLPDGREEGAGGSAGGPALLPAEGAVFLTTYRVIFTGMPTDPLVGEQVVVRSFPVAA
LTKEKRISVQTPVDQLLQDGLQLRSCTFQLLKMAFDEEVGSDSAELFRKQLHKLRYPPDV
RATFAFTLGSAHTPGRPPRVTKDKGPSLRTLSRNLVKNAKKTIGRQHVTRKKYNPPSWEH
RGQPPPEDQEDEISVSEELEPSTLTPSSALKPSDRMTMSSLVERACCRDYQRLGLGTLSS
SLSRAKSEPFRISPVNRMYAICRSYPGLLIVPQSVQDNALQRVSRCYRQNRFPVVCWRSG
RSKAVLLRSGGLHGKGVVGLFKAQNAPSPGQSQADSSSLEQEKYLQAVVSSMPRYADASG
RNTLSGFSSAHMGSHGKWGSVRTSGRSSGLGTDVGSRLAGRDALAPPQANGGPPDPGFLR
PQRAALYILGDKAQLKGVRPDPLQQWELVPIEVFEARQVKASFKKLLKACVPGCPAAEPS
PASFLRSLEDSEWLIQIHKLLQVSVLVVELLDSGSSVLVGLEDGWDITTQVVSLVQLLSD
PFYRTLEGFRLLVEKEWLSFGHRFSHRGAHTLAGQSSGFTPVFLQFLDCVHQVHLQFPME
FEFSQFYLKFLGYHHVSRRFRTFLLDSDYERIELGLLYEEKGERRGQLPCRSVWEYVDRL
SKRTPVFHNYMYAPEDAEVLRPYSNVSNLKVWDFYTEETLAEGPPYDWELAQGPPEPPEE
ERSDGGAPQSRRRVVWPCYDSCPRAQPDAISRLLEELQRLETELGRPTERWKDTWDRVKA
AQRLEGRPDGRGTPSSLLVSTAPHHRRSLGVYLQEGPVGSTLSLSLDSDQSSGSTTSGSR
QAARRSTSTLYSQFQTSESENRSYEGTLYKKGAFMKPWKARWFVLDKTKHQLRYYDHRVD
TECKGVIDLAEVEAVAPGTPTMGAPKTVDEKAFFDVKTTRRVYNFCAQDVPSAQQWVDRI
QSCLSDA
Download sequence
Identical sequences XP_016794981.1.37143 ENSPTRP00000044530 ENSPTRP00000044530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]