SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000045402 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000045402
Domain Number 1 Region: 125-282
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.18e-33
Family Dual specificity phosphatase-like 0.0000632
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000045402   Gene: ENSPTRG00000022532   Transcript: ENSPTRT00000049382
Sequence length 1160
Comment pep:known chromosome:CHIMP2.1.4:1:145452763:145486859:1 gene:ENSPTRG00000022532 transcript:ENSPTRT00000049382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATKKDTEEEQVVPSEEDEANLRAVQAHYLRSPSPSQYSMVSDAETESIFMEPIHLSSAM
AAKQIINEELKPRGVRADAECPGMLESAEQLLVEDLYNRVREKMDDTSLYNTPCVLDLQR
ALVQDRQEAPWNEVDEVWPNVFIAEKSVAVNKGRLKRLGITHILNAAHGTGVYTGPEFYT
GLEIQYLGVEVDDFPEVDISQHFRKAAEFLDEALLTYRGKVLVSSEMGISRSAVLVVAYL
VIFHNMAILEALMTVRKKRAIYPNDGFLKQLRELNEKLMEEREEDYGREGGSAEAEEGEG
TGSALGARVHALTVEEEDDSASHLSGSSLGKATQASKPLTLIDEEEEEKLYEQWKKGQGL
LSDKVPQDGGGWRSASAGQGGEELEDEDVERIIQEWQSRNERYQAEGYRRWGREEEEVKE
EESDAGSSVGRRRRTLSESSAWESVSSHDIWVLKQQLELNRPDHGRRRRADSMSSESTWD
AWNERLLEIEKEASRRYHAKSKREEAADRSSEAGSRVREDDEDSVGSEASSFYNFCSRNK
DKLTALERWKIKRIQFGFHKKDLGAGDSSSEPGAEEAVGEKNPSDISLTAYQAWKLKHQK
KVGSENKEEVVELSKGEDSALAKKRQRRLELLERSRQTLEESQSMASWEADSSTASGSIP
LSAFWSAAPSVSADGDTTSVLSTQSHRSHLSQAASNIAGCSTSNPTTPLPNLPVGPGDTI
SIASIQNWIANVVSETLAQKQNEMLLLSRSPSVASMKAVPAASCLGDDQVSMLSGQSSSS
LGGCLLPQSQARPSSDMQSVLSCNTTLSSPVESCRSKVRGTSKPIFSLFTDNVDLKELGR
KEKEMQMELREKMSEYKMEKLASDNKRSSLFKKKKVKEDEDDGVGDGDEDTDSAIGSFRY
SSRGNSQKPETDTCSSLAVCDHYASGSRVGKEMDSSVNKWLSGLRTEEKPPFQSDWSGSS
RGKYTRSSLLRETESKSSSYKFSKSQSEEQDTSSYHEANGNSVRSTSRFSSSSTREGREM
HKFSRSTYNETSSSREESPEPHFFRRTPESSEREESPEPQRPNWARSRDWEDVEESSKSD
FSEFGAKRKFTQSFMRSEEEGEKERTENREEGRFASGRRSQYRRSTDREEEEEMDDEAII
AAWRRRQEETRAKLQKRRED
Download sequence
Identical sequences ENSPTRP00000045402 9598.ENSPTRP00000045402 ENSPTRP00000045402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]