SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000045966 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000045966
Domain Number 1 Region: 306-467
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.77e-41
Family Dual specificity phosphatase-like 0.00088
Further Details:      
 
Domain Number 2 Region: 271-318
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.0000183
Family DEK C-terminal domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000045966   Gene: ENSPTRG00000003949   Transcript: ENSPTRT00000048173
Sequence length 658
Comment pep:known chromosome:CHIMP2.1.4:11:65265949:65274302:1 gene:ENSPTRG00000003949 transcript:ENSPTRT00000048173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVTVSRSPPGSGASTPVGPWDQAVQRRSRLQRRQSFAVLRGAVLGLQDGGDNDDAAEA
SSEPTEEAPSEEELRGDQTDFGQGSQSPQKQEEQRQHLHLMVQLLRPQDDIRLAAQLEAA
RPPRLRYLLVVSTRGEGLSQDETVLLGVDFPDSSSPSCTLGLVLPLWSDTQVYLDGDGGF
SVTSGGQSRIFKPISIQTMWATLQVLHQACEAALGSGLVPGGSALTWASHYQERLNSEQS
CLNEWTAMADLESLRPPSAEPGRSSEQEQMEQAIRAELWKVLDASDLESVTSKEIRQALE
LRLGLPLQQYRDFIDNQMLLLVAQRDRASRIFPHLYLGSEWNAANLEELQRNRVTHILNM
AREIDNFYPERFTYHNVRLWDEESAQLLPHWKETHRFIEAARAQGTHVLVHCKMGVSRSA
ATVLAYAMKQYECSLEQALRHVQELRPIARPNPGFLRQLQIYQGILTASRQSHVWEQKVG
GVSPEERPAPEVSTPFPPLPPEPGGGGEEKVVGMEESQAAPKEEPGPRPRINLRGVMRSI
SLLEPSLELESTSETSDMPEVFSSHESSHEEPLQPFPQLARTKGGQQVDRGPQPALKSRQ
SVVTLQGSAVVANRTQAFQEQEQGQGQGQGEPCISSTPRFRKVVRQASVHDSGEEGEA
Download sequence
Identical sequences A0A2I3SR48
ENSPTRP00000045966 ENSPTRP00000045966 XP_003313221.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]