SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000046055 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000046055
Domain Number 1 Region: 45-198
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.12e-55
Family Dual specificity phosphatase-like 0.0000000384
Further Details:      
 
Domain Number 2 Region: 199-375
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.45e-48
Family Dual specificity phosphatase-like 0.0000000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000046055   Gene: ENSPTRG00000021155   Transcript: ENSPTRT00000044963
Sequence length 498
Comment pep:known chromosome:CHIMP2.1.4:9:95280974:95401733:-1 gene:ENSPTRG00000021155 transcript:ENSPTRT00000044963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAI
LYSRPKSASNVHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVH
FTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDAAYGSCNFYITLL
DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY
HQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFADGSTPTDAIVKEFL
DICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIGPQQQFL
VMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDD
EINGVTQGDRLRALKSRRQSKTNAIPLTVILQSSVQSCKTSEPNISGSAGITKRTTRSAS
RKSSVKSLSISRTKTVLR
Download sequence
Identical sequences H2PST4 H2R3T7 O60729
NP_201588.1.87134 NP_201588.1.92137 XP_002820045.1.23681 XP_009455213.1.37143 HR4745 O60729 ENSPTRP00000046055 ENSP00000364389 ENSPTRP00000046055 9598.ENSPTRP00000046055 9600.ENSPPYP00000021757 9606.ENSP00000364389 ENSPPYP00000021757 ENSPPYP00000021757 ENSP00000364388 gi|15451936|ref|NP_201588.1| ENSP00000364389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]