SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000046131 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000046131
Domain Number 1 Region: 126-250
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.86e-32
Family Dual specificity phosphatase-like 0.00014
Further Details:      
 
Domain Number 2 Region: 9-115
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 8.07e-17
Family Cell cycle control phosphatase, catalytic domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000046131   Gene: ENSPTRG00000003154   Transcript: ENSPTRT00000045737
Sequence length 536
Comment pep:novel chromosome:CHIMP2.1.4:11:1581335:1590605:-1 gene:ENSPTRG00000003154 transcript:ENSPTRT00000045737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGDRLPRKVMDAKKLASLLRGGPGGPLVIDSRSFVEYNSWHVLSSVNICCSKLVKRRLQ
QGKVTIAELIQPAARSQVEATEPQDVVVYDQSTRDASVLAADSFLSILLSKLDGCFDSVA
ILTDVLNKDLMTQNGISYVLNASNSCPKPDFICESRFMRVPINDNYCEKLLPWLDKSIEF
IDKAKLSSCQVIVHCLAGISRSATIAIAYIMKTMGMSSDDAYRFVKDRRPSISPNFNFLG
QLLEYERSLKLLAALQGDPGTPSGTPEPPPSPAAGAPLPRLPPPTSESAATGNAAAREGC
LSAGGEPPAPPTPPTPPATSALQQGLRGLHLSSDRLQDTNRLKRSFSLDIKSAYAPSRRP
DGPGPPDPGEAPKLCKLDSPSGAALGLSSPSPDSPDAAPASRPCWPGLPGPGQRPAPGPA
PPLDSPGTPSPDGPWCFSPEGAQGAGGVLFAPFGRAGAPGPGGGSDLRRREAARAEPRDA
RTGWPEEPAPETQFKRRSCQMEFEEGMVEGRARGEELAALGKQASFSGSVEVIEVS
Download sequence
Identical sequences ENSPTRP00000046131 ENSPTRP00000046131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]