SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000046198 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000046198
Domain Number 1 Region: 201-585
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.45e-164
Family Myotubularin-like phosphatases 0.00000000000048
Further Details:      
 
Domain Number 2 Region: 75-198
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-44
Family GRAM domain 0.000000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000046198   Gene: ENSPTRG00000004195   Transcript: ENSPTRT00000046561
Sequence length 643
Comment pep:known chromosome:CHIMP2.1.4:11:93617284:93709199:-1 gene:ENSPTRG00000004195 transcript:ENSPTRT00000046561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKSSSCESLGSQPAAARPPSVDSLSSASTSHSENSVHTKSASVVSSDSISTSADNFSPD
LRVLRESNKLAEMEEPPLLPGENIKDMAKDVTYICPFTGAVRGTLTVTNYRLYFKSMERD
PPFVLDASLGVINRVEKIGGASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLM
KYAFPVSNNLPLFAFEYKEVFPENGWKLYDPLLEYRRQGIPNESWRITKINERYELCDTY
PALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQATITRCSQPMVGVSGKRSKEDE
KYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMR
ESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDG
WDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRVGHGDKNHADADRSPVF
LQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPKRTVSL
WSYINSQLEDFTNPLYGSYSNHVLYPVASMRHLELWVGYYIRWNPRMKPQEPIHNRYKEL
LAKRAELQKKVEELQREISNRSTSSSERASSPAQCVTPVQTVV
Download sequence
Identical sequences G3RYF3 H2R3W9 Q13614
ENSP00000345752 ENSPTRP00000046198 9598.ENSPTRP00000046198 9606.ENSP00000345752 gi|44680154|ref|NP_057240.3| NP_057240.3.87134 NP_057240.3.92137 XP_003828452.1.60992 XP_018892425.1.27298 XP_508710.2.37143 ENSP00000343737 ENSPTRP00000046198 ENSP00000345752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]