SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000046670 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000046670
Domain Number 1 Region: 843-1153
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.66e-91
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000543
Further Details:      
 
Domain Number 2 Region: 1111-1412
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.37e-79
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000158
Further Details:      
 
Domain Number 3 Region: 2-161
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.44e-35
Family MAM domain 0.00000659
Further Details:      
 
Domain Number 4 Region: 361-560
Classification Level Classification E-value
Superfamily Fibronectin type III 3.79e-28
Family Fibronectin type III 0.00079
Further Details:      
 
Domain Number 5 Region: 259-396
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000139
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 6 Region: 164-257
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000031
Family I set domains 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000046670   Gene: ENSPTRG00000000447   Transcript: ENSPTRT00000045323
Sequence length 1417
Comment pep:known chromosome:CHIMP2.1.4:1:29315479:29385880:1 gene:ENSPTRG00000000447 transcript:ENSPTRT00000045323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCTFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGTRAPADLPHGSYLMVNTSQHAPGQRA
HVIFQSLSENDTHCVQFSYFLYSRDGHSPGTLGVYVRVNGGPLGSAVWNMTGSHGRQWHQ
AELAVSTFWPNEYQVLFEALISPDRRGYMGLDDILLLSYPCAKAPHFSRLGDVEVNAGQN
ASFQCMAAGRAAEAERFLLQRQSGALVPAAGVRHISHRRFLATFPLAAVSRAEQDLYRCV
SQAPRGAGVSNFAELIVKEPPTPIAPPQLLRAGPTYLIIQLNTNSIIGDGPIVRKEIEYR
MARGPWAEVHAVSLQTYKLWHLDPDTEYEISVLLTRPGDGGTGRPGPPLISRTKCAEPMR
APKGLAFAEIQARQLTLQWEPLGYNVTRCHTYTVSLCYHYTLGSSHNQTIRECVKTEQGV
SRYTIKNLLPYRNVHVRLVLTNPEGRKEGKEVTFQTDEDVPSGIAAESLTFTPLEDMIFL
KWEEPQEPNGLITQYEISYQSIESSDPAVNVPGPRRTISKLRNETYHVFSNLHPGTTYLF
SVRARTGKGFGQAALTEITTNISAPSFDYADMPSPLGESENTITVLLRPAQGRGAPISVY
QVIVEEERARRLRREPGGQDCFPVPLTFEAALARGLVHYFGAELAASSLPEAMPFTVGDN
QTYRGFWNPPLEPRKAYLIYFQAASHLKGETRLNCIRIARKAACKESKRPLEVSQRSEEM
GLILGICAGGLAVLILLLGAIIVIIRKGKPVNMTKATVNYRQEKTHMMSAVDRSFTDQST
LQEDERLGLSFMDTHGYSTRGDQRSGGVTEASSLLGGSPRRPCGRKGSPYHTGQLHPAVR
VADLLQHINQMKTAEGYGFKQEYESFFEGWDATKKKDKVKGSRQEPMPAYDRHRVKLHPM
LGDPNADYINANYIDIRINREGYHRSNHFIATQGPKPEMVYDFWRMVWQEHCSSIVMITK
LVEVGRVKCSRYWPEDSDTYGDIKITLVKTETLAEYVVRTFALERRGYSARHEVRQFHFT
AWPEHGVPYHATGLLAFIRRVKASTPPDAGPIVIHCSAGTGRTGCYIVLDVMLDMAECEG
VVDIYNCVKTLCSRRVNMIQTEEQYIFIHDAILEACLCGETTIPVSEFKATYKEMIRIDP
QSNSSQLREEFQTLNSVTPPLDVEECSIALLPRNRDKNRSMDVLPPDRCLPFLISTDGDP
NNYINAALTDSYTRSAAFIVTLHPLQSTTPDFWRLVYDYGCTSIVMLNQLNQSNSAWPCL
QYWPEPGRQQYGLMEVEFMSGTADEDLVARVFRVQNISRLQEGHLLVRHFQFLRWSAYRD
TPDSKKAFLHLLAEVDKWQAESGDGRTIVHCLNGGGRSGTFCACATVLEMIRCHNLVDVF
FAAKTLRNYKPNMVETMDQYHFCYDVALEYLEGLESR
Download sequence
Identical sequences ENSPTRP00000046670 ENSPTRP00000046670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]