SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000047213 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000047213
Domain Number 1 Region: 79-222
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.36e-44
Family Dual specificity phosphatase-like 0.00000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000047213   Gene: ENSPTRG00000022403   Transcript: ENSPTRT00000048606
Sequence length 260
Comment pep:known chromosome:CHIMP2.1.4:X:154340676:154341747:1 gene:ENSPTRG00000022403 transcript:ENSPTRT00000048606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGFSRFQAECPHLCETSLGGRAGSSMAPVPSPVPVVGLGSLCLGSDCSDAESEADRDSMS
CGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNLPNFF
EKNGDFHYKQIPISDHWSQNLSQFFPEAIEFIDEALSQNCGVLVHCLAGVSRSVTVTVAY
LMQKLHLSLNDAYDLVKRKKSNISPNFNFMGQLLDFERSLRLEERHSQEQGSEGQASAAS
NPPSFFTTPTSDGAFELAPT
Download sequence
Identical sequences ENSPTRP00000047213 ENSPTRP00000047213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]